KEGG   Apis mellifera (honey bee): 726482Help
Entry
726482            CDS       T01057                                 

Gene name
GB12496
Definition
ubiquitin carboxyl-terminal hydrolase 20-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     726482 (GB12496)
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   726482 (GB12496)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG8
AA seq 886 aa AA seqDB search
MTIVFVDNVRLPRTTCPNQPDCRWVGCPETHLDHSTVHNQKFPNHCAHMNLSTNRIWCYS
CKREVITRHVPSPSISPTQVDIKAQNNKFSGDAPINIDCKTDDLNRLILDKFYGELINRV
NYEKDRLFNEKSGDSPDSTDSDESKDFSGKPRGLVGLQNIGNTCYMNAALQALSNVPPLT
QFFLDCGHMVSYMSKDRKPGLSLSYLNLIRDMWNRKTRGYVVPHGILSGIRTVHPMFRGY
HQHDTQEFLRCFMDQLHEELKEHIEDDRDNILRLKGLGEQSSDEDETEIDGNGSSQSDAE
YETCDSGVSEQSSLSDEGERGTKRRYSRVSQTEKLRSKFTNRSIKKSTVDQPFSQPQRST
QNSPVKYRTKKQMKTRSIISDIFDGKLLSSVQCLTCDRISTRVETFQDLSLPIPSRDHID
MLHQGPLTPQKAGPCSDVVYVTNQSGWLSWFLQWMRSWFWGPVVSLHDCLSAFFSADELK
GDNMYSCEKCNKLRNGIKFSKVLELPEILCVHLKRFRHELMFSSKIANYVSFPLEGLDMR
PYLHKECVSKVTMYDLISVICHHGTAGGGHYTCYALNPIVNKWFEFDDQCVTEVSSETVK
HCEAYVLFYKKWSPEMLQLRDKTMELMEISSRELSDLNFFVSRQWINRFNTFSEPGPIDN
SDFLCPHGGVNPVRAQFVDKLSMPIPQAVWEYLYNTFGGGPACTHLYECPVCEEKYESLQ
KRRQYEMEIFQQLNHNTDNPTAIYGLAMAWLRQWQSFVRGKETQPPGPIDNNSIIINKNG
QNILKVGSDYGQIPEELWQFFLTTYGGGPELMLHSCQRPVSAQSNVSLHSTSNSNLDQNF
KSNRIEAKSNKLCITRSSETISQPDSAIESLTSDSDSHQTQRDVSE
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgttttcgtggataatgttcgattaccaagaacgacatgtcccaatcagcct
gattgtcgttgggtcggatgtccagaaacacatttggatcatagtactgtacacaaccaa
aaatttcctaatcactgtgctcatatgaatctttctacaaatcgtatatggtgttactct
tgtaaaagagaagttataactaggcatgtaccatcaccatcaatatcacctactcaagtg
gatataaaagcacaaaataataagttttctggtgatgcacctattaacatagattgtaaa
actgatgatcttaatcgacttatattggataagttctatggagagcttataaatagagta
aattatgaaaaagatagattatttaatgaaaaatctggtgattcaccagatagtacagat
tcagatgagagtaaagatttttctggaaaaccaagaggtcttgttggtcttcaaaacatt
ggtaatacatgttatatgaatgcagcacttcaagctttatcaaatgtacctcctttgact
caattctttttggattgtggtcatatggttagctatatgtccaaagatagaaaacctggt
ttaagtttaagctatttaaaccttattcgagatatgtggaatagaaaaacaagaggatat
gttgtaccacatggaatattatcaggtattcgaacagttcatccaatgtttagaggatat
caccaacatgatactcaagaatttttaagatgtttcatggatcaactacatgaagaatta
aaagaacatattgaagatgatcgtgacaatatattgagattgaagggattaggagaacaa
tcttcagatgaagatgaaaccgaaattgatggaaatggttctagccaatcagatgctgaa
tatgaaacttgtgattctggagtaagtgaacaaagttctcttagtgatgaaggtgaacgt
ggtacaaaaagaagatattctcgggtatctcagacagaaaaattaagaagtaaatttaca
aatagaagcatcaaaaaatcaactgtagatcaaccattttctcagccacaaagatcaaca
caaaattcacctgtgaaatacagaactaaaaaacaaatgaaaacacgaagtatcattagt
gatatatttgatggaaaacttttaagtagcgtacaatgtctaacttgtgatagaatttca
acaagagtagaaacttttcaagatttgtcattacccattccaagtagagatcatattgat
atgttacatcaaggacctttaacaccacagaaagcaggaccatgttctgatgttgtatat
gtgactaatcaatctggttggttatcatggtttttgcaatggatgcgttcttggttctgg
ggaccagttgttagtcttcatgattgtctttctgcattttttagtgcagatgaacttaaa
ggagataatatgtacagttgtgagaagtgtaataagctacgtaatggaattaaattttca
aaagttttagagctacctgaaatattatgtgtccatttaaaaagatttcgtcatgaatta
atgtttagctcaaaaatagcaaattatgtttcatttccattagaaggcttagatatgcga
ccatatttacataaggaatgtgtatccaaagtaacaatgtatgatttaatatcagtcatt
tgtcatcatggaacagctggtggtggtcattatacttgttatgcattaaatcctattgtt
aataaatggtttgaatttgatgatcaatgtgtcacagaagtctcatcagaaactgtaaaa
cattgtgaggcttatgtgttattttataaaaagtggtcaccagaaatgttgcagttgcgt
gataaaactatggaattgatggaaatttcatctagagaattatctgatttgaattttttt
gtatcacgacaatggataaatcgttttaatacattttcggaaccaggacctatagataat
tctgattttctttgtccacatggtggtgttaatcctgttagagcacaatttgtagataaa
cttagtatgcctattccacaagcagtttgggaatatttatataatacatttggaggaggt
cctgcatgcacacatttatatgaatgcccagtttgtgaagaaaaatatgaatcattacag
aaaagaagacaatatgaaatggaaatatttcaacaattaaatcataatactgataatcct
actgctatatatggattagctatggcttggttacgtcaatggcaaagtttcgttcgtggt
aaagagactcagccacctggaccaattgacaacaattctattataataaataaaaatggt
caaaatatccttaaagttggttcagattatggacaaataccagaagaactctggcaattt
tttttaactacatatggtggaggaccagaattaatgttgcattcatgtcaaagacctgtc
tctgctcagtctaatgtatcattacattccacttcaaattcaaatttagatcagaatttt
aaatctaatcgtatagaagctaaatccaataaactctgtataactaggagttctgaaaca
atttcacaaccagatagtgctattgaaagtttaacttcagatagtgattcacatcaaaca
cagagagatgtcagtgagtaa

DBGET integrated database retrieval system