KEGG   Apis mellifera (honey bee): 726488Help
Entry
726488            CDS       T01057                                 

Definition
uncharacterized LOC726488
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ame  Apis mellifera (honey bee)
Brite
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     726488
Peptidases [BR:ame01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   726488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 926 aa AA seqDB search
MDLAMDIQNELDFQFLDLHDLNDNDKNHLINILKSNVTNNTLKLPWDTVEANNDTNASIT
EIPQLHNQWYHNVPPPPSYAQQIVCSDWQGPAMYPVPTDAHIQPFMPAMTYSHPGYNLGG
EIHDVNCNRETNRRNNRGRGIKRDNFNRGISTANEMQPGYMGEQGQFHPPLSFVVMYPDQ
TQQQQFSGHVHYPPLAIYQPNIHTHTSTHPHTQPTYGYSPYHHPSGNIRCVRQAAPILSQ
STQECTKVQTTKSHEKRVQNVYTPVKQPFHQVNEEDNSSQTNIVTTVITVNNSKVEQCTN
NVDENIINRKNSTTNGKVPPVNVKIEHNIVSTVNEKCNGAEKNDVPCVNINSSIEVKQNG
ETDKEYKNETVSSIKTTVVKTLSKPISKNESEINKEDSKKCIQDEIVIKTPSNSSNAIST
PATSLPTLSTVSWASILKKGSAETQSNPLNYKPTARINPLLITENNATPKIIQSIEKDQS
NTTLFINENISSNLQNIENENKKSQTESLQNHYNDPIAFRWVILLNYQMDKQTVSLLPRG
LTNRSNYCYINSILQALLACPPFYNLLMALPHSKNPSKMSSTPLIDNMIKFVHEFTPLSD
GARLARKDRANKRGEDIVVDIQSGVAFEPFYVYTMLKNTSAAGVFSVEGRQEDAEEFLSC
LLNGINDEMLELIKLVNNDQNVTNNIESNINYNNGEEEWKVMGPKNKGSITRCTEFGRTP
LSDIFRGQLRSRVSRAGEQPTDNVQPFFTLQLDIEKAESVKGALEILVGKDQLEGMTCSK
TKQQIEAWKQVTLEELPVILILHLKWFDYKLDGCSKIVKSVEFPIDLKLDSKFLSPNAIK
KLNPKQKHYKLFAVTYHDGKEATKGHYVTDAFHVGYGGWVRYDDSSLKGISESNVLKPTP
PRVPYLLYYRRCDTIGNNQSNSGKIR
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggatttagctatggatattcaaaatgagcttgatttccaatttttagatttacatgat
ttaaatgataatgataagaatcatttaataaacattttaaaatctaatgttactaataat
actttaaaattaccatgggatacagttgaagctaataatgatacgaatgcttccataaca
gaaattccacaacttcataatcaatggtatcataatgtgccaccaccgccctcatatgca
cagcaaatagtatgtagcgattggcaaggaccagcaatgtatcctgttccaacagatgct
catatacaaccatttatgcctgcaatgacttattctcatcctggatataatcttggaggt
gagattcatgatgttaactgtaatagagaaactaatagaagaaataatagaggaagagga
ataaaaagagataattttaatcgtggaataagtactgcaaatgaaatgcaaccaggatat
atgggagaacaaggacaatttcatcctcctttatcttttgttgttatgtatccagatcaa
acacaacaacagcaattttctggtcatgttcattatcctccattagctatatatcaacca
aatattcatacacatacaagcacacatcctcatacacaacctacttatggatattctcca
tatcatcatccttcaggaaatataagatgtgttcgacaagcagcacctatactttctcaa
tctactcaagaatgtacaaaagtacaaaccacaaaatctcatgagaaacgagtgcaaaat
gtttatacgcctgtcaaacaaccttttcatcaagtaaatgaagaagataattcttcgcag
accaatatagttactacagtaataactgtaaataatagtaaagtagaacaatgtactaat
aatgtggatgaaaatattatcaatagaaaaaattcaaccacaaatggaaaagtacctcct
gttaatgttaaaatagagcataacattgtatcgactgtaaatgaaaagtgtaatggagct
gagaaaaatgatgtaccatgcgtaaatattaatagtagtattgaagtaaaacaaaatgga
gaaaccgataaagaatacaaaaatgaaactgtttctagtattaaaactactgttgttaaa
acattatcaaaaccaatttctaaaaatgaaagtgaaataaataaagaagattctaaaaaa
tgtatccaagacgaaattgtcattaaaacaccaagcaattcatctaatgcaataagtact
cctgctacatcattaccaactttatctactgtatcttgggctagtattttaaaaaaagga
agcgcagaaacacaatcaaatccattaaattacaaaccaacagcacgcattaatcctcta
ttgattacagaaaacaatgcaacaccaaaaattatacaatcaatagaaaaagatcaatct
aatacaacattatttataaatgaaaatatatcatccaatttacaaaatattgaaaatgaa
aataaaaagtcacaaacagaatctttacagaatcattacaatgatcctattgcttttcga
tgggtgattttactaaattatcaaatggataaacaaactgtcagtttattacctagagga
ctaacaaatcgtagtaattattgttatattaatagtatattgcaagctttgcttgcttgt
ccacctttttacaatcttttaatggctctaccacattctaaaaatcctagtaaaatgtct
tccactccacttattgataatatgatcaaatttgtacatgaatttacacctttgtcagat
ggtgcacgtttagctagaaaagatagagcaaataaacgaggagaggatatagtagtagat
atacaaagtggagtggcttttgaacctttttatgtatatacaatgttaaaaaatacatca
gctgcaggtgtgttttcagtagaaggacgacaagaagatgctgaagaattcctttcgtgc
cttctgaatggtatcaatgatgaaatgcttgaacttattaaattagtaaataatgaccaa
aatgtaacaaataatattgaaagtaatataaattataacaatggagaagaagaatggaag
gttatgggtccaaaaaataaaggatctattacacggtgtactgaatttggaagaacgcca
ttatccgatatatttcgtggacaattgagatctagagtatcaagggcaggagagcaacca
accgataatgtccaacctttttttacgttacagcttgatattgaaaaagcagaatccgtt
aaaggtgcattagaaattcttgttggaaaagatcaattagaaggaatgacatgtagtaaa
acgaaacaacaaatagaagcttggaaacaagttactttagaagaattacctgtcattctt
atattacatttaaaatggtttgattacaaacttgatggttgctcaaaaattgtgaaaagt
gtagaatttccaattgatttaaaattggatagcaaattcctgtcaccaaatgctataaaa
aaattaaatcccaagcaaaaacattataaattatttgcagttacttatcatgatgggaaa
gaggcaacaaaaggtcattatgttacagatgcttttcatgttggatatggtggttgggtc
aggtatgatgatagttcattaaaaggtatttctgaaagtaatgtattaaaacctacacct
ccgagagttccatatttattatattatcgacgatgtgacactattggaaataatcaatca
aatagtggtaaaatacgttaa

DBGET integrated database retrieval system