KEGG   Apis mellifera (honey bee): 726546Help
Entry
726546            CDS       T01057                                 

Gene name
GB16350
Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
ame  Apis mellifera (honey bee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    726546 (GB16350)
Spliceosome [BR:ame03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    726546 (GB16350)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG10
AA seq 109 aa AA seqDB search
MTSSVEVIEDNSQLNENETNMDFATSEKQEARAFLRERFLRVITGIVGKQADFYLYENTR
VSAEFRGCDVECLEVYTRNLETPLGKIPEAVLRTSDIIYMDMNDINVAQ
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgactagttcggtcgaagtaattgaagataattcacaattgaacgaaaatgaaactaac
atggattttgcaacctctgaaaaacaagaagcacgcgcatttttacgcgaacgatttcta
cgtgtaattactggaattgttggcaaacaagcagatttttatttgtacgaaaatacgcgg
gtttccgccgagtttagaggttgtgatgtggaatgcttggaagtatatacacggaatttg
gaaacaccattgggcaagattccagaagctgttctaagaacaagtgacattatttatatg
gatatgaatgatattaatgtagcacaataa

DBGET integrated database retrieval system