KEGG   Apis mellifera (honey bee): 726818Help
Entry
726818            CDS       T01057                                 

Definition
beta-hexosaminidase subunit beta-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ame  Apis mellifera (honey bee)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    726818
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    726818
   00603 Glycosphingolipid biosynthesis - globo series
    726818
   00604 Glycosphingolipid biosynthesis - ganglio series
    726818
   00511 Other glycan degradation
    726818
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    726818
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     726818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG9
AA seq 565 aa AA seqDB search
MTTRWRRIVPSTVQHLFLEKASIDMRAGCLLSCLLIALAHGADSLNPDAGPWVQPTHGEP
WPMPNHRHVTDKFYLLRASTFQLNVVGKTCDIVADAVERYKAIILAEARIAKISSQGHAR
SQIRDNTTITDTLNTLNIHLREPCEKDGNHWPYLGMDESYKLNINETSTVDLYAKTVWGI
LRGLETFSQLLIPTGDGSNLKIRCQSIVDFARLPHRGLLLDTSRHYLPIHDILLTLDAMS
YNKMNVLHWHIVDDNSFPYQSSSYPNLSAKGAYHPSMVYTLNDIQQIVDYARLRGIRVMP
EFDTPGHTRSWGLAYPELLTTCYDVKGKPNGKLGPMNPTNPALYEFLRNLFAEIVQVFPD
QYVHLGGDEVPFDCWKSNPEINSYMKSRNMSSYNLLESEYIGRLLRITDSLEANTIVWQE
VFENGVVMPNTTVVHVWTGLWAKKLEEATKAGHPVLLSACWYLDHIVNPRDWKKFYACDP
LAFNKTVNSSHLMLGGEACMWGEFVDKNNVHPKIWPHASATAERLWTFVKQDDNKAAQRL
EEHACRMNRRGIPAQPPNGPGFCVM
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcgctggcgtcgcatcgttccttccaccgtgcaacacctgttcctcgaaaaa
gcgtcgatcgacatgagggccggctgccttctctcgtgcctgttgatcgccctcgcacac
ggggccgactcgttgaacccggacgctggcccctgggtccaacccactcacggcgagccc
tggccgatgcccaaccaccgccacgtgaccgataagttctatcttctgcgagcctcgacc
tttcagttgaacgtagtcgggaaaacgtgcgacatcgtggccgatgccgttgagaggtac
aaggcgattatactggccgaggcgcggatagcgaaaatttcctctcaaggtcacgcgaga
tcccaaataagggacaacacgaccatcaccgatactctcaacactttgaatatccatttg
agggagccatgcgagaaggatggcaaccattggccctatttagggatggacgaatcatac
aagctgaacataaacgaaacatcgacggtggatctgtacgcgaaaactgtatgggggatt
cttcgaggattggaaacgttttctcagcttttgatcccgaccggggatggatcgaacttg
aagataagatgccaaagtatcgtagatttcgcgaggctgcctcatcgtggactcctgttg
gacacgtctcgccattaccttcccattcacgacatactgctcacgctggacgccatgtct
tacaacaaaatgaacgttctccactggcacatcgtggacgacaatagcttcccctatcaa
agctccagctatccgaatttgtccgccaagggtgcataccatccctcgatggtgtacacg
ctcaatgatatccagcagatcgtcgactatgcaaggctgaggggtatccgggtgatgccg
gaattcgatactcctggacataccaggtcatggggtttagcctatcccgaattgttgacc
acttgttacgatgtgaagggaaagccgaatggtaaattgggcccgatgaatccgacgaat
ccggctctgtacgagttcctccgcaacttattcgccgagatcgtgcaagtgttcccggat
caatacgttcatctgggcggagacgaggtgccgttcgattgttggaagagcaatcccgag
atcaattcgtacatgaagtcgcgcaacatgtccagttacaatcttctcgagagcgaatat
atcggcaggcttcttcgtatcacggactcgcttgaggccaacacgatcgtttggcaggag
gtgttcgagaacggggtggtgatgccgaatacgacggtggtgcacgtgtggactggcctc
tgggcgaagaagttggaagaggccacgaaagccggacatccggtgctgttgtcggcctgt
tggtacctcgatcacatagttaaccctcgtgattggaagaaattctacgcgtgtgatcct
ttggcgttcaacaaaaccgtcaactcgtcccacttgatgctgggtggcgaagcgtgcatg
tggggagaattcgtggacaagaacaacgtgcatccgaaaatatggcctcatgccagcgca
accgcggaacgtctttggacttttgtgaaacaagacgacaacaaggccgcccaacgtctc
gaggagcacgcttgtcggatgaacagacgaggaatcccggcgcaaccgccgaatggaccc
ggattctgcgtgatgtaa

DBGET integrated database retrieval system