KEGG   Apis mellifera (honey bee): 726824Help
Entry
726824            CDS       T01057                                 

Definition
putative inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    726824
  Energy metabolism
   00920 Sulfur metabolism
    726824
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    726824
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     726824
    3.1.3.25  inositol-phosphate phosphatase
     726824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 328 aa AA seqDB search
MSVRTRKTIFCGIIILLSVLYLYTNRTLYTDLQDKNISLKLLLIAAIKAAEIGGSEVIAV
HNQAKFEIQSKGKTKEGINDPVTEADYRSHCAMVHSLLETFPSITVISEETSKNCDKITI
SNIKNNINNLNDYDIKDEIININDITVWIDPLDATKEFTENLLQYVTTMVCIAVKGKPII
GVIYKPFETKQNSSLFWSWTNHAISRNLQILHKLEDERIPILIVSQSHAGQIYNVSKIAF
GKDIKIVPAAGAGNSFSGNVTAYVXHDCNKKWDICAGTAILTALGGTVTQLFDQQLISFR
PHDSKELTWGLLATMSNHVWYLDKFSNI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtccgaacaagaaaaacaattttttgtggaattattatattattaagtgtatta
tacttatatacaaatcgaactttatatacagatttacaggataaaaatatttctttaaag
ttacttcttattgctgctataaaagcagcagaaattggtggttctgaagtaattgcagtt
cacaatcaagcaaaattcgaaatacaaagtaaaggaaaaacgaaagagggtataaatgac
ccagtaacagaagcagattatagatcacactgtgcaatggtccattctttattagaaaca
tttccaagtataacagtaatatcagaggaaacatcaaaaaattgtgataaaattacaata
tcaaatataaaaaataatataaataatttaaatgattatgatattaaggatgaaattata
aatataaatgacattacagtctggattgatccccttgatgcaacaaaagaatttacagaa
aacttattacaatatgttacaactatggtttgtattgctgtaaaaggaaaacctataata
ggtgttatatataaaccatttgaaacaaagcaaaattctagtcttttttggtcatggact
aatcatgcaatttcaagaaatttacaaatattgcataagttagaagatgaaagaatacca
atattgattgtatcacaatcacatgctggccaaatttataatgtttctaagattgcattt
ggtaaagatataaaaattgttcctgcagctggtgcaggtaattcttttagtggaaatgta
actgcatatgtcnnacatgactgcaataaaaaatgggacatttgtgcaggaactgcaatt
cttactgctcttggtggtacagttactcaattgtttgatcaacaattgataagctttaga
cctcatgattctaaagaacttacatggggtcttttagctaccatgagtaatcatgtttgg
tatttagataaattttcaaacatttaa

DBGET integrated database retrieval system