KEGG   Apis mellifera (honey bee): 726824Help
Entry
726824            CDS       T01057                                 

Definition
putative inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ame00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ame00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ame04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG1
AA seq 328 aa AA seqDB search
MSVRTRKTIFCGIIILLSVLYLYTNRTLYTDLQDKNISLKLLLIAAIKAAEIGGSEVIAV
HNQAKFEIQSKGKTKEGINDPVTEADYRSHCAMVHSLLETFPSITVISEETSKNCDKITI
SNIKNNINNLNDYDIKDEIININDITVWIDPLDATKEFTENLLQYVTTMVCIAVKGKPII
GVIYKPFETKQNSSLFWSWTNHAISRNLQILHKLEDERIPILIVSQSHAGQIYNVSKIAF
GKDIKIVPAAGAGNSFSGNVTAYVXHDCNKKWDICAGTAILTALGGTVTQLFDQQLISFR
PHDSKELTWGLLATMSNHVWYLDKFSNI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtccgaacaagaaaaacaattttttgtggaattattatattattaagtgtatta
tacttatatacaaatcgaactttatatacagatttacaggataaaaatatttctttaaag
ttacttcttattgctgctataaaagcagcagaaattggtggttctgaagtaattgcagtt
cacaatcaagcaaaattcgaaatacaaagtaaaggaaaaacgaaagagggtataaatgac
ccagtaacagaagcagattatagatcacactgtgcaatggtccattctttattagaaaca
tttccaagtataacagtaatatcagaggaaacatcaaaaaattgtgataaaattacaata
tcaaatataaaaaataatataaataatttaaatgattatgatattaaggatgaaattata
aatataaatgacattacagtctggattgatccccttgatgcaacaaaagaatttacagaa
aacttattacaatatgttacaactatggtttgtattgctgtaaaaggaaaacctataata
ggtgttatatataaaccatttgaaacaaagcaaaattctagtcttttttggtcatggact
aatcatgcaatttcaagaaatttacaaatattgcataagttagaagatgaaagaatacca
atattgattgtatcacaatcacatgctggccaaatttataatgtttctaagattgcattt
ggtaaagatataaaaattgttcctgcagctggtgcaggtaattcttttagtggaaatgta
actgcatatgtcnnacatgactgcaataaaaaatgggacatttgtgcaggaactgcaatt
cttactgctcttggtggtacagttactcaattgtttgatcaacaattgataagctttaga
cctcatgattctaaagaacttacatggggtcttttagctaccatgagtaatcatgtttgg
tatttagataaattttcaaacatttaa

DBGET integrated database retrieval system