KEGG   Apis mellifera (honey bee): 726899Help
Entry
726899            CDS       T01057                                 

Gene name
GB12440
Definition
e3 ubiquitin-protein ligase IAP-3-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
ame  Apis mellifera (honey bee)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ame00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    726899 (GB12440)
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    726899 (GB12440)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG2
AA seq 375 aa AA seqDB search
MTNIKLKDFKNDSNLKTSTNPYLTSSIFITPHILNDEDEVDNIDYHFEEARLQSFKNWPV
SYIKPEKLAAAGFYYTGEYDKVRCFECQVEICQWVQGDIPMVDHQRWSARCRFICKINCG
NVPIGIDSNTIVQPRSSHDLEHRLTSGVDNYNFSTELQLSSIAKSNCLNLKEPKKPIHPE
YASYDARLNTFSTWPKFMLQTKEQLADAGFYYTGKSDQTICYYCGCGLKDWEPEDNPWEQ
HAKWYSKCYYLLMIKGQDYVNKVTGRHISSSSIQETISRCRNSNSELDYQNNSVETNVSS
IESIRENAENLSNIKVQNNKSTDDAKICKICYNQELEVVFLPCGHVIACVKCANDMKSCA
VCRKLVTKTVRIFFS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgactaatatcaaactcaaagattttaaaaatgattcaaatctcaaaacttcaacaaat
ccatatttaacatcatcaattttcataacacctcatatattgaatgatgaagatgaagta
gataatattgattatcattttgaagaagcaagacttcaaagttttaaaaattggcctgta
tcatatataaaacctgaaaaacttgccgctgctggattttattatacgggtgaatatgat
aaagttagatgttttgaatgtcaagttgagatatgtcaatgggtacaaggtgatattcca
atggttgatcatcagagatggtcagcaagatgtagatttatttgtaaaataaattgtggt
aatgtaccaattggaatagattctaatacaattgtacaaccaagaagttctcatgactta
gaacatcggcttacatctggtgttgataattataatttttcaactgaattacaattatca
agcattgctaaatctaattgtttaaacttgaaagagcctaaaaaacctatacatcctgaa
tatgctagttatgatgcaaggttgaatacattttcaacttggccaaaatttatgttacaa
acaaaagaacaattagcagatgcaggtttttattatacaggaaaaagtgatcaaactata
tgttattattgtggatgtggtttaaaagattgggaaccagaagataatccttgggaacaa
catgcaaaatggtattctaaatgttattatttattaatgattaaaggacaagattatgtg
aataaagtaacaggccggcatatatcttcatcttccatacaagaaacaatatcaagatgt
agaaatagcaattcagaattagattatcaaaataatagtgtagagactaatgtaagcagt
atagaatctataagggagaatgcagaaaatttatcaaatataaaagtacaaaataataaa
tcaacagatgatgcaaaaatatgtaaaatctgttacaatcaagaattagaagtagtattt
ttaccatgtggacatgtgatcgcttgtgtaaaatgtgctaatgatatgaaatcttgtgca
gtgtgcagaaaacttgttacaaagactgtacggatttttttctcgtag

DBGET integrated database retrieval system