KEGG   Apis mellifera (honey bee): 727061Help
Entry
727061            CDS       T01057                                 

Gene name
Ndufs5, GB18086
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)
Orthology
K03938  
NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
ame  Apis mellifera (honey bee)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    727061 (Ndufs5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
LG5
AA seq 106 aa AA seqDB search
MDNKPPKYHTFMEPLFTSPITDYFGISLHAQCYSACKDFELRLAECVEAYGFFKGQEKCE
PLILDLDECLYKEKRKHRQEIISGEFQRQIDAGERKHEKAPFLFFF
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggataataaaccaccaaaatatcatacttttatggaacctttatttacaagtccaatc
accgattactttggaatttcacttcatgctcaatgttattcagcttgtaaagattttgaa
ttgcgcttagctgaatgtgtggaagcatatggattttttaaaggacaagagaaatgtgaa
ccactaattcttgatcttgatgaatgtttgtataaagagaaacggaaacacagacaagaa
ataataagcggagaatttcaacgtcagatagatgctggagaaagaaaacatgagaaagct
ccatttctttttttcttttag

DBGET integrated database retrieval system