KEGG   Apis mellifera (honey bee): 727456Help
Entry
727456            CDS       T01057                                 

Gene name
GB18480
Definition
glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ame  Apis mellifera (honey bee)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    727456 (GB18480)
Enzymes [BR:ame01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     727456 (GB18480)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
Position
Un
AA seq 278 aa AA seqDB search
MAAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKQAVFDGKKAIRGGIPFVF
PQFGAWTFGPPHGFARIVRWNVEKSPERLPSGDVEAIFSIMDSEFTRSMWNYPFKLTYRL
ILREKELHFNIGVYNPSKDHTFSFNLLLHTYFKVPDVRRCQITGLHGCTFIDKTRDNQIF
QEGRDVVTVCEWTDRIYQNTQPEHIITNVVSGRKMRVQKYNFPDTVVWNPWQEKARDIPD
FGDDEFPNMICVESGHVSSPVILLPGTAFEASQILQVM
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggctactagcgttgtcgtgctcgacaggggcaacaataccacctgcacgatt
aatttacacggagctaccgtggtatcctggagagtaaataatcaagaacaactgtttgta
agtaagcaagctgtatttgatggaaagaaagctattagaggaggcattcctttcgttttt
ccacaatttggagcatggacatttggaccgcctcatggtttcgcgagaatcgttcgttgg
aatgtggaaaaatctcctgaacgtttaccaagtggtgatgtcgaggcaattttctctatt
atggacagtgaattcactcgttctatgtggaattatccatttaaattaacatatagatta
attcttcgggagaaggaattacatttcaatattggcgtatacaatcctagtaaagatcac
acttttagttttaatttgttattacatacatacttcaaagtgccagatgttagaagatgc
cagattactggtcttcatggatgcacatttatcgacaagacaagagataaccaaattttt
caagaaggtcgcgatgtagtaactgtatgtgaatggacagatagaatttatcagaataca
caaccagaacacattattaccaatgttgtatctggtagaaaaatgcgagtacaaaaatac
aattttcccgatacagtggtttggaatccgtggcaggaaaaagctcgtgatataccagat
tttggagatgacgaatttccaaatatgatatgcgtagaaagtggacacgttagcagtcca
gtgatcctactccctggaacagctttcgaagccagtcaaatcttgcaggtaatgtga

DBGET integrated database retrieval system