KEGG   Apis mellifera (honey bee): 751102Help
Entry
751102            CDS       T01057                                 

Gene name
Tbh, GB16337
Definition
tyramine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ame00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 613 aa AA seqDB search
MPLPLLDHNIMVPCTRINARIGGKAVLYEVFVLSDLKALVEIGDKKAKDHELLKDGSCLF
WHNHHQNREDNSERKDVHTIPLSSDITFYWRVDFMSEIIIAEVHYTSIDNTWFAIGFSEY
GKLKSADYCVLWIDWHRQIQLQDAWADEEGKLNLDLQQDCENFAWRRRGNITKFTFSRKF
DTCDENDYIMERGTTHLVWLKGLGPLSSLTGLQVSDAETAGMSRTELIRTLHKKPIFPSN
AWQLEILTDRVKVPNKETTYWCRVQKLPPILSQKHHILQFGPVIQTGNEHLVHHMEVFHC
AGPINFEIPMYDGPCDGADRPEKTQICKKVLAAWAMGADAFVYPEEAGLSIGGQDFNPYI
MLEIHYNNPEFQNGNIDSSGIRLEYTDKMAIPPQQEAFTLSGHCIQECTGIGLPQYGIHI
FASQLHTHLTGIKVITRHIRDGEELPLLNYDNHYSTHFQEIRLLPKPVIILPGDSLITTC
TYNTMDRENITLGGFAISDEMCVNYIHYYPNTRLEVCKSAISNDALRTYFRYMREWENQP
ISIDNGISSNYKSIEWTKVRVQALHDLYEAAPLGMQCNGSDGSRLPGLWDNIAASPVKLP
LPPPARNCPEIRH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgccactgctggatcataatatcatggtaccctgcacccgtattaatgccaga
atcggcggcaaagcagtattatatgaagtcttcgtcctttcggatttaaaagcgttagta
gaaattggtgataagaaggcgaaggatcatgaacttttaaaagatggatcatgtttattt
tggcataatcatcatcaaaatagagaagataattcagaaagaaaagatgttcatacaatt
ccgcttagttcagatatcactttctattggagagttgattttatgagtgagatcataatc
gcagaagttcattatacaagtattgacaatacttggttcgctataggtttttcagagtat
ggtaaattaaaatctgccgattattgtgttttgtggattgattggcatcgtcaaattcaa
ttacaagatgcttgggcagatgaagaaggaaaattaaatttagatttgcaacaggattgt
gagaattttgcatggagaagaagaggaaatataacaaaattcactttttcaaggaaattt
gatacttgcgatgaaaatgattatatcatggagagaggtactacacatttagtatggcta
aaaggtttaggaccactatcatctttgactggtttgcaagtatccgatgcagaaactgct
ggtatgtctagaacagaattaatcaggacgcttcataagaaaccaatatttccttcaaat
gcttggcagttagaaatattaacagatcgtgtgaaagtaccgaacaaagaaacaacttat
tggtgccgtgtacaaaaattacctcctattttgtctcaaaaacatcatatcttacagttt
ggtccagtcatccaaacaggcaacgaacatttagttcatcatatggaagtttttcattgt
gctggaccaataaattttgaaattcctatgtatgacggtccttgtgatggagctgataga
ccagagaaaactcaaatatgtaagaaagttttagcagcatgggccatgggggcagatgct
tttgtctatccagaagaagctggtctttcaattggtggccaagattttaatccttacatc
atgctggagattcattacaataatcctgaatttcaaaatgggaacatcgattcttcagga
attcgcttagaatatactgataaaatggctattcctccacaacaagaagcttttacttta
tctggacattgcatacaagaatgtacaggcattggtctcccacaatatggtattcatatt
ttcgcatcgcaacttcatacacatttaacaggcataaaagttattactcgtcatattaga
gacggggaagaattacctttattaaattatgacaatcattattccactcattttcaagaa
attcgactcttaccaaaacctgttattattttaccaggagattcgttaataacaacttgt
acgtataatacaatggatagagaaaatattactcttggcggatttgccatttccgatgaa
atgtgtgtgaattatattcactattatcctaatactcgattagaggtttgtaaaagtgct
attagcaatgatgctctaagaacttattttcgatatatgagagaatgggaaaatcaacca
attagtatcgataatggtatctcttcaaattataaaagcatcgagtggaccaaagttcgc
gtacaagctttgcatgatctatatgaagctgcacctttaggaatgcaatgcaatggatcc
gatggatctcgacttcctggactatgggataacatagcagcttcaccagttaaactaccc
ttacctccgccagctcgaaattgtccagagattcgtcattaa

DBGET integrated database retrieval system