KEGG   Apis mellifera (honey bee): 751102Help
Entry
751102            CDS       T01057                                 

Gene name
Tbh, GB16337
Definition
tyramine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    751102 (Tbh)
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     751102 (Tbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEEBASE: 
UniProt: 
Position
LG3
AA seq 613 aa AA seqDB search
MPLPLLDHNIMVPCTRINARIGGKAVLYEVFVLSDLKALVEIGDKKAKDHELLKDGSCLF
WHNHHQNREDNSERKDVHTIPLSSDITFYWRVDFMSEIIIAEVHYTSIDNTWFAIGFSEY
GKLKSADYCVLWIDWHRQIQLQDAWADEEGKLNLDLQQDCENFAWRRRGNITKFTFSRKF
DTCDENDYIMERGTTHLVWLKGLGPLSSLTGLQVSDAETAGMSRTELIRTLHKKPIFPSN
AWQLEILTDRVKVPNKETTYWCRVQKLPPILSQKHHILQFGPVIQTGNEHLVHHMEVFHC
AGPINFEIPMYDGPCDGADRPEKTQICKKVLAAWAMGADAFVYPEEAGLSIGGQDFNPYI
MLEIHYNNPEFQNGNIDSSGIRLEYTDKMAIPPQQEAFTLSGHCIQECTGIGLPQYGIHI
FASQLHTHLTGIKVITRHIRDGEELPLLNYDNHYSTHFQEIRLLPKPVIILPGDSLITTC
TYNTMDRENITLGGFAISDEMCVNYIHYYPNTRLEVCKSAISNDALRTYFRYMREWENQP
ISIDNGISSNYKSIEWTKVRVQALHDLYEAAPLGMQCNGSDGSRLPGLWDNIAASPVKLP
LPPPARNCPEIRH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgccactgctggatcataatatcatggtaccctgcacccgtattaatgccaga
atcggcggcaaagcagtattatatgaagtcttcgtcctttcggatttaaaagcgttagta
gaaattggtgataagaaggcgaaggatcatgaacttttaaaagatggatcatgtttattt
tggcataatcatcatcaaaatagagaagataattcagaaagaaaagatgttcatacaatt
ccgcttagttcagatatcactttctattggagagttgattttatgagtgagatcataatc
gcagaagttcattatacaagtattgacaatacttggttcgctataggtttttcagagtat
ggtaaattaaaatctgccgattattgtgttttgtggattgattggcatcgtcaaattcaa
ttacaagatgcttgggcagatgaagaaggaaaattaaatttagatttgcaacaggattgt
gagaattttgcatggagaagaagaggaaatataacaaaattcactttttcaaggaaattt
gatacttgcgatgaaaatgattatatcatggagagaggtactacacatttagtatggcta
aaaggtttaggaccactatcatctttgactggtttgcaagtatccgatgcagaaactgct
ggtatgtctagaacagaattaatcaggacgcttcataagaaaccaatatttccttcaaat
gcttggcagttagaaatattaacagatcgtgtgaaagtaccgaacaaagaaacaacttat
tggtgccgtgtacaaaaattacctcctattttgtctcaaaaacatcatatcttacagttt
ggtccagtcatccaaacaggcaacgaacatttagttcatcatatggaagtttttcattgt
gctggaccaataaattttgaaattcctatgtatgacggtccttgtgatggagctgataga
ccagagaaaactcaaatatgtaagaaagttttagcagcatgggccatgggggcagatgct
tttgtctatccagaagaagctggtctttcaattggtggccaagattttaatccttacatc
atgctggagattcattacaataatcctgaatttcaaaatgggaacatcgattcttcagga
attcgcttagaatatactgataaaatggctattcctccacaacaagaagcttttacttta
tctggacattgcatacaagaatgtacaggcattggtctcccacaatatggtattcatatt
ttcgcatcgcaacttcatacacatttaacaggcataaaagttattactcgtcatattaga
gacggggaagaattacctttattaaattatgacaatcattattccactcattttcaagaa
attcgactcttaccaaaacctgttattattttaccaggagattcgttaataacaacttgt
acgtataatacaatggatagagaaaatattactcttggcggatttgccatttccgatgaa
atgtgtgtgaattatattcactattatcctaatactcgattagaggtttgtaaaagtgct
attagcaatgatgctctaagaacttattttcgatatatgagagaatgggaaaatcaacca
attagtatcgataatggtatctcttcaaattataaaagcatcgagtggaccaaagttcgc
gtacaagctttgcatgatctatatgaagctgcacctttaggaatgcaatgcaatggatcc
gatggatctcgacttcctggactatgggataacatagcagcttcaccagttaaactaccc
ttacctccgccagctcgaaattgtccagagattcgtcattaa

DBGET integrated database retrieval system