KEGG   Aeromonas media: B224_0323Help
Entry
B224_0323         CDS       T03075                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amed  Aeromonas media
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amed00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B224_0323
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B224_0323
  Energy metabolism
   00680 Methane metabolism
    B224_0323
Enzymes [BR:amed01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B224_0323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(238090..240723)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSSRKGNESDRERLLETL
RTLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQECTPDPLEQMFAKLKASNLSQE
AIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALELSDLLPRERDKILNRIEQ
LVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMRNLDERLQHHLGVRLPLDA
APVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVNLFYRDIKELTSELSMADCTEAVR
ARVGDNPEPYRALVRELREQLRETQEFLTAKVQGQASESRDLIKTTAQLREPLELCYHSL
HACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERHGQVFSELTRYLGMGDYAEWSE
DDKQAFLLNELNSRRPLIPTDWAPSDETRETIDTCRVIAGHDPDAFGIYIISMAGAPSDV
LAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMDRLLSVDWYRGYIQGRQYVMIGYSD
SAKDAGMMAAGWAQYAAMESLVGLAEANNIRLTLFHGRGGTVGRGGAPAHQAILSQPPGS
LRGGLRVTEQGEMIRFKFGLPKVAIHSLNLYTSAVLEGNLLPPPKPKECWRAVMEQLATV
SCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLGSRPAKRKPNGGVESLRAIPWIFAWTQ
NRLMLPAWLGAHKGLQQAIDDGQKSVLDEMSRQWPFFRTRLEMLEMVFLKADLWLAEYYD
TRLVPKELWALGKQLRQELSDSIQVVLELRPQGDLLDDQPWIKESIKLRNPYTDPLNVLQ
VELLGRSRKNPETLHPELDQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagtacgccgccctacgggccaacgtaggcatgttgggccaactgctgggg
aaatccatcaaggatcatcagggtcaagccttcctcgacaagattgagaccattcgtcaa
ctggccaagtcctcccgcaagggcaacgagtcagaccgggaacgcctgctagagaccctg
cgtactctctccgatgacgagctgctgcccgtggcccgcgccttcagccagttcctcaat
ctggccaacgtggcggagcagttccacaccatctcccgccgctgcgaagagcaggagtgc
acgccggacccgcttgagcaaatgttcgccaagctgaaagcctccaacctctcccaggag
gctatcatccaggcggtacgcgagctggacatcgacctggtgctgaccgcccaccccacc
gaggtgacccgtcgcaccctgatccacaagcacgtgcagctcaacgactgcctggaagcg
ctggagctctccgatctgctgccccgcgagcgggacaagatcctcaatcgcatcgaacag
ctggtcaatcaggcctggcacaccaacgagatccgcgagcagcgtccgaccccggtggac
gaagccaagtggggcttcgccgtggtggaaaacagcctgtggccggccattcccgaattc
atgcgcaatctggacgagcggctgcaacaccacctgggtgtgcgcctgccgctggatgcc
gcgccggtcaagttcacctcctggatgggcggtgaccgcgacggcaaccccttcgtcacc
gccaaggtgaccgccgaggtgctggagctgggtcgctggatggcggtcaacctcttctac
cgcgacatcaaggagctcacctcagagctctccatggccgactgtaccgaggccgtgcgc
gcccgggtcggtgacaaccccgagccctaccgcgccctggtgcgcgagctgcgcgagcag
ctgcgcgagacccaggagttcctcaccgccaaggtgcagggtcaggcgagcgagagccgc
gatctcatcaagaccacggcccagctgcgcgagccgctggagctctgctaccactccctg
cacgcctgcggcatgggcaacatcgccgacggcatgctgctggacgtgctgcgcaagctg
gcctgcttcggcatccatctggtcaagctggacatccgccaggacggtgagcgtcatggt
caggtcttctccgagctgacccgctacctcggcatgggtgactacgccgagtggagcgag
gacgacaagcaggccttcctgctcaacgaactgaactcccgccgcccgctgatccccacc
gactgggcaccgagcgacgagacccgcgagaccatagacacctgccgggtgatcgccggt
cacgaccccgatgcgttcggcatctacatcatctccatggccggtgcaccgtccgacgtc
ctggcggtgcagctgctgctgaaggaggcgggttgcaagttccgcatgccggtcgccccg
ctgttcgagacccaggaagatctgatggcgggtaccgccgtgatggatcgcctgctgtcg
gtggactggtatcgcggctacatccagggtcgtcagtacgtgatgatcggttactcggat
tccgccaaggacgcgggcatgatggccgccggctgggcccagtacgccgccatggaatcc
ctggtggggctggcggaagccaacaacatccgcctgaccctgttccatggccgtggcggt
accgtcggtcgcggcggcgcccccgcccatcaggcgatcctgtcccaaccgccgggatcc
ctgcgcggtggtctgcgggtcaccgaacagggcgagatgatccgcttcaagttcggtctg
cccaaggtcgccatccacagcctgaacctctacaccagcgccgtgctggaggggaacctg
ctgccgccacccaagcccaaggagtgctggcgcgccgtgatggagcagctggccaccgtc
tcctgcgatcactaccgcagtatagtgcgcggccacccggactttgtgccctacttccgc
gccgccaccccggagatggagctcggcaagctgccgctcggttcccgtcccgccaagcgc
aagcccaacggcggcgtcgaaagcctgcgcgccatcccctggatcttcgcctggacccag
aaccggctgatgctgccagcctggctcggtgcccacaagggtctgcagcaggccatagat
gacggtcagaagagcgtgctggacgagatgagccgccagtggcccttcttccgcacccgt
ctcgagatgctggaaatggtgttcctcaaggccgacctctggctggcggagtactacgac
acccgtctggtgcccaaagagctgtgggccctcggcaagcaactgcgtcaggagctctcc
gactccattcaggtggtgctggagctgcgcccgcagggagacctgctggacgaccagccc
tggatcaaggagtccatcaagctgcgcaacccctacaccgacccgctcaacgtgctgcag
gtcgagctgctgggtcgctcgcgcaaaaaccctgaaactctgcaccccgagctggatcag
gcgctgatggtcaccatcgccggtatcgccgccggcatgcgcaacacgggttga

DBGET integrated database retrieval system