KEGG   Aeromonas media: B224_0427Help
Entry
B224_0427         CDS       T03075                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
amed  Aeromonas media
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amed00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B224_0427
Enzymes [BR:amed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B224_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(321204..323780)
Genome map
AA seq 858 aa AA seqDB search
MHNTVFRTAMLAAVLGSFSHTAAAEGVMVHLFQWKFNDIATECETVLGPKGFGGVQITPP
AEHKQGSQVWWTVYQPISFKNFNSFGGSEAELRSMIARCNAVGVKVYADAVFNQLASGTG
TATGGGSYNSGQYQYPQFGYNDFHHSGDITNYGDSNNVWNGALYGMPDLNTGSPYVQDQI
ATYMKTLLGWGVAGFRIDAAKHMAPSEVKAILDKAGSPKAYLEVIGAGGESPDIQPGRYT
YIDTVTDFKYGTDLAANFNSQIKNLKTLGESWGLLPSNKAFVFVVNHDRERGHGGGGMLT
FMSGARYDLANTFMMAWPYGWKQVMSGYRFENMGTYETDKGAPGSTPCTDGQWNCEQRRP
TIMNMALFHNRTEGQPVSNWWDNGNNQIAFGRGDKGFVAINNESGSLIASVQTGLPAGEY
CNLLGGNDYCSGGYVTVDGSGKASLNVSGMKAAAIIAGCTKASPCGGSALPGNKFSSMNL
RGTPNAWGNTPMTVDANRVWSATLTLTGNGDATGAQRFKFDVFGNWAENYGDNEGDGIAD
KGSSKDILVSGAGTYRITLSEGDLRYTITPLTSNQAPVAALSPKTLSIKAGESVVFDGSA
STDDEGVASYSWSTGGSAPTETVQFDTPGTHTVTLTVTDAEGLTASANATVTVTDSNAAY
NSVLPTLHLRGTPNAWGSLAMTLVADNQWEALATFDGQANQRFKFDVKGDWTQNYGDTNK
DGVAEQGGADILTQVTGQYRVRFNDQTLQYSLNPVSIGYAKNIVSLNIRGTTNGWGTTPM
TLVSDHLWQANVNFTGTGDASGGQRFKFDVKGDWTQNYGDTNKDGVAELAGTDITTAVIG
AYVVRFNDQTLTYSLSAQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacacagtgtttcgaaccgccatgctcgccgcggtgctgggctcattcagccac
acagccgccgccgaaggggtcatggtccatctgttccaatggaaattcaacgacatcgcc
accgagtgcgagaccgtgctcggtcccaagggattcggcggtgtccagatcacccccccc
gccgaacacaagcagggcagccaggtctggtggaccgtctatcagcccatcagcttcaag
aacttcaacagcttcggcggcagtgaggcggagctcaggagcatgatcgcccgctgcaac
gccgtcggggtcaaggtctacgccgatgccgtcttcaaccagctggcctcgggcaccggg
accgccaccggcggcggcagctacaactcggggcaatatcagtatccccagttcggctac
aacgacttccaccacagcggcgacatcaccaactacggcgacagcaacaacgtctggaac
ggcgccctctacggcatgccggatctcaacaccggctcgccctacgtgcaggatcagatc
gccacctacatgaagaccctgcttggctggggcgtggcgggctttcgtatcgatgcggcc
aaacacatggccccgagcgaggtgaaggccatcctcgacaaggcaggcagccccaaggcc
tacctggaggtgatcggcgcaggcggagagtcccccgacatccaaccgggccgctacacc
tacatcgacaccgtcaccgacttcaaatacggcacggatctggccgccaacttcaacagc
cagatcaagaacctcaagacgctcggcgagagctggggtctgctcccctccaacaaggcc
ttcgtcttcgtggtcaaccacgaccgcgaacgtggccacggtggcggcggcatgctcacc
ttcatgagcggcgcccgctacgatctggccaacaccttcatgatggcctggccctatggc
tggaagcaggtgatgtcgggctaccgcttcgaaaacatgggcacctatgaaaccgacaag
ggggcaccgggcagtacgccctgcaccgatggccaatggaactgcgaacaacgtcgcccg
accatcatgaacatggccctgttccacaacaggaccgaaggccagccagtcagcaactgg
tgggataacggcaacaaccagatagccttcggtcggggagacaagggctttgtcgccatc
aacaacgagagcggcagcctgatagcctcggtgcagaccggcctgccagcgggcgagtac
tgcaacctcctcggcggcaatgactactgcagcggcggctatgtcaccgtcgacggcagc
ggcaaggccagcctgaacgtgtccggcatgaaggccgccgccatcattgccggttgcacc
aaggccagcccctgcggtggttctgcactgccgggcaacaagttcagcagcatgaacctg
cgcggcacccccaacgcctggggcaacacccccatgacagtcgatgccaaccgtgtctgg
tccgccacccttaccctgaccggcaacggtgatgccaccggcgcccaacgcttcaagttc
gacgtcttcggcaactgggccgagaactacggcgacaacgaaggggacggcatcgccgac
aagggcagcagcaaggatatcctggtcagcggggcgggcacctaccgcatcaccctgagc
gaaggcgacctgcgctatacgatcactcccctcaccagcaaccaggcaccggtcgccgcc
ctctcgcccaagaccctcagcatcaaggcgggggaaagcgtggtgttcgatggctccgcc
tccaccgatgatgaaggtgtggcgagctacagctggtccaccggcggcagcgcccccacg
gagacagtccagttcgataccccgggcacccataccgtcaccctgacggtcactgatgcc
gaagggctgaccgccagtgccaacgccacagtgacagtcaccgacagcaacgccgcctac
aacagcgtgctgccgaccctgcacctgcgcggcacccccaatgcctggggatcccttgcc
atgacgctggttgccgacaatcagtgggaggcattggccaccttcgacggccaggccaac
cagcgcttcaagttcgacgtcaagggagactggacccagaactacggtgacaccaacaag
gatggcgtggccgaacaggggggcgccgacatactgacccaggtcactggccagtaccgg
gtgcgcttcaacgaccagaccctgcaatacagcctgaacccggtcagcatcggctatgcc
aagaacatcgtcagcctgaatatccgtggcaccaccaatggctggggcacaacccccatg
acgctggtgagcgatcacctctggcaagccaacgtcaatttcaccgggaccggtgatgcc
agcggcggccagcgcttcaagttcgacgtcaagggagactggacccagaactacggcgac
accaacaaggacggcgtggccgagctggccgggacagacatcaccacggcagtaatcggt
gcctatgtggtgcgcttcaacgaccagactctgacctacagcttgagcgcccagtaa

DBGET integrated database retrieval system