KEGG   Aeromonas media: B224_3185Help
Entry
B224_3185         CDS       T03075                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
amed  Aeromonas media
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amed00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B224_3185
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B224_3185
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B224_3185
Enzymes [BR:amed01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B224_3185
Exosome [BR:amed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B224_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2517584..2518975
Genome map
AA seq 463 aa AA seqDB search
MRNMAGLAVMIGATLVAGCNSNNDSSTPEPSAKNVIFFLGDGMGLNTLTAARIYGVGEEG
SLTIDTLPETAFIKTFSHDAQVTDSAPSMAAYMTGVKSNNGVISMDSDATYESDCSQSAG
KPVTTLLELAKADGRGTGVVTSTRVTHATPAATYAHICNRDLEADIAAQLVPGGAGYNGA
LKEGLDVVLGGGSSFFLPKADKGKREDGRNLIDEMQAKGYQFASTLDELNQAEAGKPLLG
LFGSSHMKYDLDRPASEPSLAQMTLAAIKQLKDKEKGYFLMVEGGRIDHALHDTNAKRAL
QDTLAFDDAIKATLDEVKKTDPELKNTLIVVTADHDHTLVLNGYAKRTGKTTAGNPGVLG
LVKNYETGEPSKDSDGMPYTIIGFGNGYNRVDGPRSSVAPLDDATVSADDYHQEVVVKVG
EIGNETHGGTDVFLGAIGQGADSFHGSLDNTAVFGKVKAAAKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatggcaggacttgcagtgatgataggcgccaccctggtcgccggctgcaac
tccaacaatgacagcagcacccccgagcccagcgccaaaaacgtcatcttcttcctcggc
gacggcatgggcctcaacaccctgaccgcggcccgcatctacggcgtcggggaagagggc
agcctcaccatcgacaccctgccggagacggccttcatcaagaccttctcccacgacgcc
caggtcaccgactcggccccctccatggcggcctacatgacgggggtcaagagcaacaac
ggcgtcatcagcatggacagcgacgccacctatgagagcgactgcagccagagcgccggc
aagccggtcaccaccctgctggagctggccaaggccgacggccgcggcaccggcgtggtc
accagtacccgggtgacccacgccaccccggccgccacctatgcccacatctgcaaccgg
gatctggaggcggacatcgccgcccagctggtaccgggcggtgctggttacaacggcgcc
ctgaaagaggggctggacgtggtgctcggcggcggcagcagcttcttcttgcccaaggcc
gacaagggcaagcgggaggacggccgcaacctcatcgacgagatgcaggccaagggctac
cagtttgccagcaccctggacgagctgaaccaggccgaggcgggcaagccgctgctgggg
ctgtttggttcgagccacatgaaatatgacctggaccggcctgccagcgagccgtcactg
gcccagatgaccctggccgcgatcaagcagctcaaggacaaggagaagggctacttcctg
atggtggaagggggtcgcatcgatcacgccctgcacgacaccaacgccaagcgcgccctg
caggataccctcgccttcgacgacgccatcaaggccaccctggacgaggtgaagaaaacc
gaccccgagctgaaaaacaccctgatcgtggtcaccgccgaccatgaccacaccctggta
ctcaacgggtacgccaagcgcaccggcaagaccacggccggcaaccccggggtgctcggg
ctggtgaagaactacgagaccggcgagccgagcaaggacagcgacggcatgccctacacc
atcatcggctttggcaacggctacaaccgggtggatggcccgcgcagcagcgtggcgccg
ctggacgatgccaccgtctcggccgacgactatcaccaggaggtggtggtcaaggtgggc
gagatcggcaacgagacccacggcggcaccgacgtcttcctcggcgccataggccaggga
gctgacagcttccacggttcactcgataacaccgccgtgttcggcaaggtcaaggctgcg
gccaagctgtga

DBGET integrated database retrieval system