KEGG   Aeromonas media: B224_3813Help
Entry
B224_3813         CDS       T03075                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
amed  Aeromonas media
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amed00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B224_3813
   00650 Butanoate metabolism
    B224_3813
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B224_3813
   00280 Valine, leucine and isoleucine degradation
    B224_3813
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B224_3813
Enzymes [BR:amed01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B224_3813
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B224_3813
Amino acid related enzymes [BR:amed01007]
 Aminotransferase (transaminase)
  Class III
   B224_3813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3009544..3010821
Genome map
AA seq 425 aa AA seqDB search
MSNQSWQARREAAVVQGVGTLLPVFIDRAQNAELWDVEGNRYIDFASGIAVLNTGHNHPK
VVAAVREQLEKFSHTCFQVTPYPGYIELAEKLNALMPGTTPKRTLFLSTGAEAVENAIKI
ARAHTGRSGTIAFKGGFHGRTMMGMALTGKVVPYKTGFGPFPGEVYHLPFPADYLGVSEA
DALAALDLCFSADIEPARVAAIIIEPVQGEGGFYVASPSFLQALRKICDQHGILLICDEI
QSGFCRTGKTFAIEYSGVEPDIMTLAKSLAGGFPLSAVVGKAAIMNAAKPGGLGGTYAGS
PIACAAALAVLTVIEEERLNQQALAQGEQIKARLHQLAERFDCIGDIRGPGAMVAMELVK
GRDASQPAPDLTKRLVAEAGKRGLVLLACGVRGNVIRFLAPLTAPAAIIDEGLLLLEQSL
VASLT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccaatcctggcaggcccgccgtgaagcggccgtggtacagggcgtcggcacc
ctgctgccggtcttcatcgaccgggcccagaacgccgagctgtgggacgtggagggcaac
cgctacatcgactttgcctccggcatcgccgtgctcaacaccggccacaaccaccccaag
gtggtcgccgccgtgcgcgaacagctcgagaagttcagtcacacctgcttccaggtcacc
ccctatccgggctatatcgagctggccgagaagctcaacgccctgatgccgggcaccacc
cccaaacgtaccctgttcctctccaccggcgccgaggcggtggagaacgccatcaagatc
gcccgcgcccacaccggtcgcagcggcaccatcgccttcaaggggggctttcacggccgc
accatgatggggatggcactcaccggcaaggtggtgccctacaagaccggcttcggcccc
ttcccgggagaggtctatcacctgcccttcccggccgactacctgggggtgagcgaggcg
gatgccctggcggcgctggatctctgcttcagcgccgacatcgagccggcccgggtggcc
gccatcatcatagagccggtacagggtgaggggggcttctatgtcgcctccccgagcttc
ctgcaagccctgcgcaagatctgcgaccagcacggcatcctgctcatctgcgacgagatc
cagagcggtttctgtcgcaccggcaagaccttcgccatcgaatacagcggcgtcgagccg
gacatcatgacgctggcgaagagcctggcgggtggtttccccctctccgccgtggtgggc
aaggcagccatcatgaacgccgccaagccaggcggtctcggcggcacctatgcgggctcc
cccatcgcctgcgccgccgccctggcggtgctgacggtgatcgaggaggagcggctcaat
cagcaagccctggcccagggcgagcagatcaaggcgcgactgcaccagttggcggagcgg
tttgactgcatcggtgacatccgcggccccggggccatggtggccatggagctggtcaag
gggcgcgatgccagtcagccagccccggacctcaccaagcggctggtggccgaggcgggc
aagcgcggcctggtgctgctggcctgcggcgtacgcgggaacgtgatccgtttcctcgct
cccctgaccgccccggcggccatcatcgatgaagggctgctcttgctcgagcaatccctg
gtggcctcattgacctga

DBGET integrated database retrieval system