KEGG   Astyanax mexicanus (Mexican tetra): 103035021Help
Entry
103035021         CDS       T05042                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103035021 (abhd6)
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S33
   103035021 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
22
AA seq 339 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPAVLIKVYYWYWRRRLGMQLDYAEYEGYRF
CYTHRGKPGSRPSILMLHGFSAHKDMWMGMVKFLPTNMHLVCVDMPGHEGTTRTNAADYS
IEGQVKRIHQFVKSIHLNKKPFHLMGTSMGGNVAGVYAARYPSDLCSVTLICPAGLKDTE
ESTFVKRLRDLEKTNDIQKIPLIPSNPEEMEEMLKLCSFVRFKIPQQILQGLVSVRIPHN
DFYREVFMELVKEDSRHSLHDNMHLISTPLQVIWGKQDQVLDVSGAAALAKALPGCQVDL
LDNCGHTVVMERPRKAANLVVDFINRHQNSGSSSNKKLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatctggacgtggtgaacatgtttgtcatcgccggcggcacgctggccatccccata
ctggcttttgtggcatcttttcttctgtggcctgcggtcctcattaaggtctattactgg
tactggaggaggaggctggggatgcagctggattacgcagagtatgaaggatatcgcttc
tgctacacacacagagggaagccgggcagcagaccctccatactcatgcttcacggcttc
tctgcacacaaagacatgtggatggggatggtgaagttcctcccaaccaacatgcaccta
gtgtgtgttgacatgcctggccacgagggcaccacacgcaccaatgcagccgactactcc
atcgagggccaagtcaaacgcatacatcagtttgttaaaagcattcatctaaataagaag
cccttccacctgatgggcacctccatgggcggtaatgtagctggagtctacgctgcccgc
tacccctccgacctgtgcagcgtcacactcatctgtcctgcaggtctgaaggacactgag
gagagcacatttgtgaaacgtctgagagacttggaaaagaccaacgatattcagaagatt
cctctcatcccttctaatccggaggagatggaggagatgctgaaactgtgctccttcgtc
cgtttcaagatccctcagcagattcttcagggattggtcagtgtccgtattccacacaac
gacttctaccgcgaggtgtttatggaactggttaaagaagattcgaggcacagcctgcat
gataacatgcacctcatctcaacaccactgcaggtcatttgggggaaacaagaccaggtt
ctggacgtatcaggagccgctgctctggccaaagctctgcctggatgccaggttgatctg
ctggataactgtggccacaccgtggtgatggagcgccctcgcaaggcagctaaccttgta
gtggactttatcaaccgccaccagaactctggcagcagcagcaacaaaaagctctcttga

DBGET integrated database retrieval system