KEGG   Astyanax mexicanus (Mexican tetra): 103035683Help
Entry
103035683         CDS       T05042                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103035683
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103035683
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103035683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
25
AA seq 354 aa AA seqDB search
MMRRRVDGAAASDSTEGKSGKDKAVKVRARSSWRVWIKWTFLVLCVLYAAPRVIPRLFPA
FVQHMVYSHAILWFVDLSRPADLALNHTINMYLSSEEGITLGVWHTVPEHKWKEAQGKDL
EWYEKSLGDGSPVFIYLHANMHNRAAPHRIGVANLLSSLGYHAVVMDYRGFGDSTGEPTE
NGLITDSLYLYHWVKVRSKDSLVIIWGHSIGTLVATNTAVKLQEQGNPADGVMIEGAFTD
AINEKYGPPFTWFYLKFPWYFFSAPPKESKRAESNADNLKKMRTPLLILHSEDDQVVPFT
MAQELYSTAKSAPNLKEQVKLISFDGSLGYRHNGLYRDPALPGILREFVQSLIS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggagaagagttgatggagctgctgcttctgatagcactgagggaaaatcgggg
aaggacaaagctgtgaaagtgagagcaagatcttcatggagagtgtggataaaatggacg
ttcctggtgctctgtgttctgtatgcggccccacgggttataccacgcctctttcctgcc
tttgtacagcacatggtttattcacatgctatattgtggttcgttgacctgagtcgtcct
gctgacctcgctcttaatcacaccattaatatgtacctgagctctgaagaggggataaca
ctgggcgtgtggcacactgtgcctgagcacaagtggaaggaggcgcaggggaaggatctg
gagtggtatgagaagtctttgggtgatgggtcgcctgttttcatctatctacatgcaaat
atgcataacagagccgccccccatcggataggagttgccaacctcctgagttctctgggt
tatcatgcagttgttatggactacagaggatttggagactccactggtgagcccacagaa
aatggactgatcactgactccctctacctgtaccactgggtaaaggtccgcagtaaagac
agtctggtgatcatatggggacactcaataggcacacttgtagcaactaatactgcagtg
aaacttcaggagcaaggaaaccctgctgatggtgtgatgattgaaggtgcgtttactgat
gccataaatgagaagtacggtcctccttttacttggttttacctgaagtttccttggtat
tttttttctgctccacccaaagaaagcaagcgtgccgagtcaaacgcagataatttgaag
aaaatgaggacgcctcttttgattcttcattctgaagatgaccaagtggttccctttaca
atggctcaagagctttacagcacagccaaaagtgcaccaaatttaaaggaacaagtcaaa
ctaatatcgtttgatggatctcttggatatcgccataatggactctacagggaccctgca
ttgcctggtattttaagggagtttgtgcagtcactgatatcataa

DBGET integrated database retrieval system