KEGG   Anaplasma marginale Florida: AMF_1021Help
Entry
AMF_1021          CDS       T00855                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
amf  Anaplasma marginale Florida
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1188472..1189674)
Genome map
AA seq 400 aa AA seqDB search
MLTFVFFVGVRVEVQGMSDVRLDDPVSLACRLMSYPSVTPDRSGAIPFLAELLSDLGFRC
EILSFGNGDVEVKNLYAQYGNGHPNLCFAGHTDVVPPGGTWRTDPFSPQVKDGMLYGRGA
SDMKAAICAYISAVARLDSVPGCLSFLITGDEEGRWREYGTKSVLDWMTKNGICPDYCVL
GEPSSRKRLGDCISIGRRGSLNFELSCRGVQGHVAYPELAHNPIDDVLCILRKIKDTTLD
SGTDHFPPSHCEITSIDVGNDVENLIPSSATAAFNIRFNDLHTAESLYRDMDAICASVTS
NYTLSHRCFGGASISQPSCYTATLCEVVKEVTGLDARLITDGGTSDACIISSFCPVAELG
LPSGTAHKVDECVSVADVLTLAEIYHRFINRFFAVAQSRS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctaacctttgtcttttttgtgggtgtgcgcgtggaagttcaaggtatgtctgatgtg
cgcctggatgacccagtgtcgctggcctgcaggctcatgtcttaccctagtgttacgccg
gatagaagcggtgccataccgttcctggcagagctgttgtcggatttagggttcaggtgc
gaaattctgtccttcggaaatggcgatgtagaggtgaaaaacctatacgcgcaatacgga
aacggccatcccaatctgtgtttcgctggccacactgatgtggtgccgcctgggggcacc
tggcgtactgatccattctccccgcaggtgaaagacggtatgctatacggccgtggtgca
tccgacatgaaggctgcgatttgcgcgtacatttctgcggttgcccggctggattcggtg
cctgggtgccttagctttcttattacaggtgatgaggaggggcgctggcgggagtatgga
accaaatctgttttagattggatgacaaagaacgggatttgcccggactactgcgtgttg
ggagagcccagtagccgtaagcgtttgggagattgcatatccatagggcgcaggggttcc
ttaaattttgagctgtcgtgtcgtggcgtacaggggcatgtcgcatatccggagctggcg
cataaccccatagacgatgtgctttgtatcttgcgtaagatcaaagacaccaccctggat
agtggtaccgaccactttcctccctcgcattgcgagataacaagtattgacgttggcaat
gatgtggagaatttaatcccgtcgtccgccactgcggcgtttaacataaggtttaatgac
ctccataccgcggaatctctataccgggacatggacgcaatatgcgcctcagtgacaagc
aactacacgctctcccataggtgctttggcggtgcatctatcagtcaaccctcttgctac
acagcaactttgtgtgaggttgtaaaggaggtaaccgggctggatgcaaggctgattacg
gatggagggacgtccgatgcatgcatcattagtagcttttgcccagtagccgagctcggc
ttgcccagcggtactgcccacaaagtagatgaatgcgtgtcagttgcagatgtgctaaca
cttgcggagatatatcacaggttcattaacaggttttttgctgttgctcagagccgtagt
tag

DBGET integrated database retrieval system