KEGG   Anaplasma marginale Florida: AMF_132Help
Entry
AMF_132           CDS       T00855                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase (gmk)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amf  Anaplasma marginale Florida
Pathway
amf00230  Purine metabolism
amf01100  Metabolic pathways
Module
amf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMF_132 (gmk)
Enzymes [BR:amf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AMF_132 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Rad17 ATP-synt_ab AAA NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACM49020
UniProt: B9KHQ8
Position
149959..150693
Genome map
AA seq 244 aa AA seqDB search
MLWAEHTMHRGLFRLKVGHVDDISGLWHGNCRGVVGLKLTSEGIMLVLSSPSGCGKTTVS
DLIIKNSDNNIIRSVSATTRAPREGEVNGRDYFFLSEAEFLLMCESGEMMEHAKVFGNYY
GIPRKFVAENISSGKNILFVIDWQGAYRLMETMKESVVSVFMMPPSMDELERRMSDRGGI
DGVARERLKGAPFEISHCYRYDYIIVNEDAEETARKIGCIIGAESKRVSRQMGLRELIDK
NFPL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgttgtgggctgagcacactatgcaccggggtttatttcggttgaaagttgggcacgtt
gatgatataagcggcctctggcacgggaattgcaggggtgttgtgggcctaaagctgaca
agtgaaggtataatgctggtgctctcctcaccctctgggtgcggcaagaccaccgtgtct
gaccttatcatcaaaaacagtgataacaacataatacgctcggtttccgcaaccacgagg
gctcctagggagggtgaggttaacggtagggactactttttcctcagcgaagcggagttt
ttgctgatgtgcgaatctggtgagatgatggagcacgcgaaagttttcgggaattactac
ggcataccgcggaagtttgtggcagaaaacatcagtagcgggaaaaacatactgtttgtg
atcgattggcagggggcctacaggctaatggaaacgatgaaagaatcagtagtgagtgtt
ttcatgatgcctccttccatggatgagttagagcgtcgcatgagcgaccgaggcggtatt
gatggtgttgcgagggagaggcttaaaggcgccccattcgagatcagtcactgctaccgc
tacgattacataatagtcaacgaagatgctgaggaaaccgcgcgcaagataggctgtatt
attggtgcagagagcaagagggtgtctaggcagatggggttgagggagcttatagacaaa
aacttcccgttgtga

DBGET integrated database retrieval system