KEGG   Anaplasma marginale Florida: AMF_142Help
Entry
AMF_142           CDS       T00855                                 

Gene name
cycM
Definition
(GenBank) cytochrome C (cycM)
  KO
K08738  cytochrome c
Organism
amf  Anaplasma marginale Florida
Pathway
amf01100  Metabolic pathways
amf01120  Microbial metabolism in diverse environments
amf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMF_142 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACM49027
UniProt: B9KHR5
Position
complement(160246..160785)
Genome map
AA seq 179 aa AA seqDB search
MGVGFRFNRVATAILLASFVILLVSNVVDLLYNPDEDPPRGYSVDVGSKQPAATDAGAGD
AQQEVDLASLMSNASPDRGKSVSKKCVACHTFDKGGPNRVGPNLWGIIGAKKCNTPGFTY
SKALSSMQGDWSEEELFKFLKSPQSYASGTRMSFVGLSKPQDIADLLAYMKQLKQQEGE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgtgggtttcaggttcaatagagttgccactgccatcttgttggcgtccttcgtg
atattattggtgagcaacgtagttgatctgctctataaccccgacgaagacccgcccaga
gggtacagcgtagatgttggcagtaagcagcctgccgctacggacgcgggagcgggtgat
gcccagcaagaggtagatttagcatctctgatgtcaaacgccagcccggatagggggaag
agcgtatccaaaaagtgcgtcgcgtgccacacctttgacaaaggcggccccaacagagta
ggccccaacctgtggggcattataggtgcaaaaaagtgcaacacccccgggttcacatac
tctaaggcgttgtctagcatgcagggcgactggagtgaggaagagttatttaaattcctc
aaaagcccacagagctatgccagcggaactcgtatgtccttcgtgggcctttcaaaaccc
caagatatcgcagatctgcttgcgtatatgaagcagcttaagcagcaggaaggcgaatag

DBGET integrated database retrieval system