KEGG   Anaplasma marginale Florida: AMF_168Help
Entry
AMF_168           CDS       T00855                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain (sucC)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amf  Anaplasma marginale Florida
Pathway
amf00020  Citrate cycle (TCA cycle)
amf00640  Propanoate metabolism
amf01100  Metabolic pathways
amf01110  Biosynthesis of secondary metabolites
amf01120  Microbial metabolism in diverse environments
amf01130  Biosynthesis of antibiotics
amf01200  Carbon metabolism
Module
amf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMF_168 (sucC)
   00640 Propanoate metabolism
    AMF_168 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AMF_168 (sucC)
Enzymes [BR:amf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMF_168 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACM49049
UniProt: B9KHT7
Position
complement(190535..191734)
Genome map
AA seq 399 aa AA seqDB search
MRSLCFTGAVVVNVHEFQAKGVLSSFGVTVPRGVVVESVEEVDRLLGDLAPGLVAVKAQI
HAGGRGKAGGVKIGKTKDEVKSLVKQMLHSVLITHQTSPEGQKVNKVYLEEGVDIGKEYY
ISAVVDRSVGRVSIIFSSEGGVDIETVAKERPNMVSVVHVDPLYGFRSFHGQELCRRFGL
GPKQVSGVVSMARKIYKVLVETDASQVEINPMAETSSGEFLALDAKIAFDDNGLYRNPEI
AKLQDPDEYAAEELEAAKHGLSYIKMDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDV
GGGANQEAVREAFKIILQSGVKGILVNIFGGIMRCDVIAKGIIESTKEIGVDVPLVVRLS
GTNFEIGRKLLDDSGLGITAAADLDEAASFIVKMVNERR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtctttgtgttttacaggagcagtagttgtgaacgttcatgagtttcaggcgaag
ggtgttttgagtagcttcggtgttaccgtgccccggggtgtcgtggttgagtcggtagag
gaggttgatcgcctgttaggagatctagctccaggcttggtggcggtgaaggctcagatc
cacgccggaggcaggggtaaggccggaggcgttaagataggaaagaccaaggacgaagtg
aagtcgctcgtgaagcagatgctgcactccgttctgataacacaccaaacttctcccgag
gggcagaaagtcaacaaggtctacttggaagaaggggttgacataggcaaggagtattac
ataagcgcggttgtagatcgcagcgttggcagggtcagtattatcttctccagtgaaggc
ggggttgatattgaaacggtcgcaaaggagcgccccaatatggtctctgtggtgcatgtt
gatcccctatatggttttcgttccttccacgggcaggagttgtgccgccggtttggcctt
ggccccaagcaagtctctggtgtcgtgtctatggcgcgcaagatttataaagttttggtg
gagacggacgcaagccaggtagaaatcaaccctatggctgagacgtctagtggtgagttt
ctcgcgctagacgcgaagattgcgtttgacgacaatgggttgtatcgcaacccggaaatt
gcaaagctgcaagacccagatgagtacgcggctgaggagctggaagctgcgaagcacggg
ctgagctacataaaaatggacggcaatataggctgcatggtaaacggcgcgggcctcgcc
atggcgaccatggacataataaagtactacggtggagagccggcaaactttttggacgtg
ggcggaggtgcaaaccaagaagcagtgcgtgaggctttcaagataatactacaaagcggt
gtgaagggcatactggtaaacatattcggcggaattatgcgttgcgacgtaatagccaag
ggtataatagaatccaccaaggagattggcgtggacgtaccgctcgtggtcaggttgtcc
ggcactaattttgagattgggcggaaactcctggatgattccggtctcgggataaccgcg
gcagcagatttggacgaggccgccagctttattgttaagatggtaaatgagagaaggtag

DBGET integrated database retrieval system