KEGG   Anaplasma marginale Florida: AMF_217Help
Entry
AMF_217           CDS       T00855                                 

Gene name
sdhD
Definition
succinate dehyrdrogenase subunit D (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amf  Anaplasma marginale Florida
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMF_217 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMF_217 (sdhD)
   00650 Butanoate metabolism
    AMF_217 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AMF_217 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
248257..248607
Genome map
AA seq 116 aa AA seqDB search
MVVVLALMGGRSVYFWWMQRIAGLVMLPVPFLFAFFYRSYGFESVHAADYGFCASVSAIA
LLVAAFYHGVLGVQVVLEDYVHSEVLRAFMITFFRLFALVTVCAVTLAMLFGHNIR
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttggttgtagttctggctcttatgggtggaaggtctgtatatttttggtggatgcaaaga
atagctgggctggttatgctgcccgtaccgtttttgtttgcgtttttctaccgctcttac
ggttttgagtctgtccatgctgcggactatggcttttgtgccagcgtatctgctattgcg
cttcttgttgccgcgttttaccacggggttttgggcgtgcaggtggtcctggaggattac
gtccactccgaagttctgcgcgccttcatgattacattcttcaggctatttgccctggtc
accgtgtgtgcggtaaccttggcgatgctttttggacataacattaggtga

DBGET integrated database retrieval system