KEGG   Anaplasma marginale Florida: AMF_286Help
Entry
AMF_286           CDS       T00855                                 

Gene name
recR
Definition
recombination protein (recR)
Orthology
K06187  
recombination protein RecR
Organism
amf  Anaplasma marginale Florida
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349281..349793
Genome map
AA seq 170 aa AA seqDB search
MHLLRHRQDVMVPLAAGIRELEMHTKECTICHNLDTISPCSICSDKGRDQSIICVVEELG
DLWAFERGRIYSGVYHVLGGALSALSGIGPEDLNLGGIVDRIRTHGVKEVIVATSNDMDG
QVTCHYIAQMVKGTDAKVTRLACGIPLGGEIDYLDEGTLRAALSSRYVIT
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgcatctgttgcggcataggcaggacgtaatggtgcccctcgctgccggaattagagag
ttagaaatgcacactaaggagtgcacaatctgccacaatttagacaccatttctccctgc
tccatatgttccgataagggtcgggaccaaagcattatctgtgttgttgaggagttgggt
gacttgtgggctttcgagcgcgggagaatatattccggggtataccacgtgctgggggga
gcattgtctgccctctctggtattggtccggaagacctaaatctgggtggaattgtagat
aggattcgcacgcatggggttaaagaagtcatcgttgcaacgagcaatgacatggacgga
caagtgacgtgccattacatagctcagatggtgaagggcactgatgccaaggtgactagg
cttgcatgtggcattcctcttgggggagagatagactacctagacgagggcacgctacgc
gcggctctctcctcaaggtacgtcattacctag

DBGET integrated database retrieval system