KEGG   Anaplasma marginale Florida: AMF_416Help
Entry
AMF_416           CDS       T00855                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amf  Anaplasma marginale Florida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMF_416 (tpiA)
   01230 Biosynthesis of amino acids
    AMF_416 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMF_416 (tpiA)
   00051 Fructose and mannose metabolism
    AMF_416 (tpiA)
   00562 Inositol phosphate metabolism
    AMF_416 (tpiA)
Enzymes [BR:amf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMF_416 (tpiA)
Exosome [BR:amf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMF_416 (tpiA)
  Exosomal proteins of bladder cancer cells
   AMF_416 (tpiA)
  Exosomal proteins of melanoma cells
   AMF_416 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
517271..518077
Genome map
AA seq 268 aa AA seqDB search
MVEHLTCNQGVVGSSPAAGSLVLSVELMSFLVVANWKMNGDTALVRDFLAAIDTSFASDL
LNKGPLELVICPPFTLMSAFDSRCPSVRLGAQNCFSGVSKGCTGEISAAMLKECGCDYVI
LGHSDRRGTFAEENSDIRLKAESAIEEGITPIICVGETLQERNSGISSDILVEQCSKCCP
KYGEFIIAYEPVWAIGGSTIPDLEIIRESFDTIRSHGSARTILYGGSVNQGNIRALKSQI
DGLSGVLVGSAGTKVDEFCGIISNVLEL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagcacctgacttgtaatcagggggttgtcggttcgagtccggcagccggctct
cttgtactgagtgtggagcttatgtcctttcttgtcgtagctaactggaagatgaatggg
gataccgctctggtgagggattttcttgctgcgattgacaccagctttgcatcggacctt
ctcaacaaaggcccgcttgaattggtcatatgccctccgtttactttgatgtcagcgttc
gactctaggtgtccatcggtaaggcttggggcgcagaactgcttttctggggttagtaaa
ggctgtactggtgagataagtgctgcaatgttaaaagagtgtggctgtgactatgtcatc
cttgggcactctgataggcgtggtacatttgctgaagaaaattcagacatcagactaaag
gctgaatccgctatagaagaggggattacacctataatatgcgttggtgagacactgcag
gaaaggaatagtggcatctctagtgatatactagtcgagcaatgcagcaaatgttgcccg
aagtacggggaatttataattgcatacgaaccggtttgggccataggaggctcaactatt
cctgatttagagataataagagaatcttttgatacaatcaggtcccatggttctgcgcgt
accatactttacggcgggtctgtaaaccagggcaacatacgcgctctaaagtcacaaatt
gatggcctatctggagtgctggttggaagtgcaggaacgaaagtagatgagttttgcgga
attataagcaatgtgttggaattatag

DBGET integrated database retrieval system