KEGG   Anaplasma marginale Florida: AMF_821Help
Entry
AMF_821           CDS       T00855                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase component (sucB) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amf  Anaplasma marginale Florida
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMF_821 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMF_821 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AMF_821 (sucB)
Enzymes [BR:amf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMF_821 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985476..986789)
Genome map
AA seq 437 aa AA seqDB search
MVWCLDWRSIRPAYSSFIGQAACMSDNVEIKVDNLGGESISEAPVRVLKKVGDAVSAEEA
VFIVETDKTSLEIASPVAGVITELRVSDEEIITRGQVLAIISKHEGAPQDAAAREHKQAE
VATPDAELAPQVEQRDAQAQVADKEKPVKPVTGPRIPGIDEFVAGGCSSPADRAAGKITK
PVGDVGKSPVPQQRVYDEVDGVISVPGERRVKMSKIRQVIASRLKESQNTAATLSTFNEV
DMSAVMALRGKYKEGFEKKYEVKLGFMSFFIKAVVLALREIPVINAEISGDEIIYRDYCN
IGVAVGTDKGLVVPVIRGAETMSFAALEQELVMLSKKARGGTLTVADMSGATFTITNGGV
YGSLLSTPIINPPQSGILGMHAIQERPVVVNGNIEIRPMMYLALSYDHRIVDGQGAVTFL
VRVKQYIEDPNRMSLEI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggtttggtgcctagactggcggtccatccgtccggcatatagttcgtttattgggcaa
gctgcttgtatgagtgataatgtagagataaaagttgataaccttggtggggaatccata
tcagaggcccctgttcgggttctgaaaaaggttggtgatgccgtttccgcagaagaggcg
gtttttattgttgaaacggataaaacctctctggagatagcatctccggttgccggtgtt
atcaccgaactgcgcgtgtcggatgaagagataataaccaggggccaggttttggcgatc
atcagcaagcatgaaggtgcccctcaggatgccgcagcgcgtgagcacaagcaagctgaa
gttgcaactccagatgccgaattagcaccgcaggttgagcaacgtgatgcgcaagctcaa
gttgctgacaaggaaaagccggttaagccggtcactggcccacgcattcctggtatagac
gagttcgtcgccggtgggtgttcctcacctgctgatagggcggctggtaaaatcaccaag
cctgtgggcgatgtgggcaagagccccgtcccgcagcaacgcgtgtatgatgaggttgac
ggcgtcataagcgtgccaggagaaaggcgcgttaagatgagcaaaatccgccaggtgatc
gcgtcacggctgaaggaatcgcaaaacaccgcagccacgctcagcacttttaatgaggtg
gatatgagtgctgttatggcgctcagggggaaatataaggaaggctttgagaagaagtat
gaggtgaaactggggttcatgtcgttcttcatcaaggccgtggtgctggctctcagagag
ataccggtgattaatgctgagatttccggggatgagataatataccgcgactactgcaat
atcggggttgcggtcggcacggataaggggttagtagtgccggtgatacgcggggccgag
accatgtcgtttgcggcattagagcaagagttggtgatgctgagtaagaaggccagggga
gggacgctcacagttgctgatatgtctggcgcaacgtttaccatcaccaatggtggagta
tatgggtctcttctttccacaccgattattaaccctcctcagtcagggattctgggcatg
cacgcgatacaagagcgccccgtggtggtcaacggcaatattgaaatcaggcccatgatg
tatctcgcgctttcgtatgaccacagaatagtggatggtcaaggtgcggtgaccttcctc
gtgcgcgtcaagcaatatatagaagatccgaacaggatgtctctcgagatttag

DBGET integrated database retrieval system