KEGG   Anaplasma marginale Florida: AMF_845Help
Entry
AMF_845           CDS       T00855                                 

Gene name
trkH
Definition
potassium uptake protein trkH (trkH) (EC:3.6.3.14)
Orthology
K03498  
trk system potassium uptake protein TrkH
Organism
amf  Anaplasma marginale Florida
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1011207..1012778)
Genome map
AA seq 523 aa AA seqDB search
MSAASALGCRECWFLVAAVRNEACDTSLTHWRALVFVQGAFSLLFALFLLVPMAVDFFMG
GEDWEGFATAFSVSAVVGSVCLHFGKSGPIGRHETVYLICAVWTVLSILAAIPFLVSETA
KLSYADALFEAVSGLTTTGATVLYNLQAKSPGILLWRVMLNFIGGLGVIAIGVLLLPCLK
VVGLKDIYGVESATARQRFKLSVFRTVLYISCMYAMLLVLCTGAYKIAGMSAFDAICHAM
STVSTGGFANYDSSLGHFNSAAIEIVAIVFMLLSSCPFVVYLRLALEGRFRSKQFVVFVC
VLVVFSLLGAVNLYSRNMLPEAEFPEVLRRSAFILVSLVTSTGFSNCDYSSWGFLAVSGT
ILTLCGGCSGSTNSGLKMHRIVILVRGGYRYVKHMLMRTPFTVSEQSAREEALPEAGAFF
FLYVFVFCIACIIVAWSEDDLATIVTSVSSTFTNTGPGIGDVVGPHGTYAPVSATVKFVL
TVLMLIGRLELVPVFVLILSLLRGGAGRLLGIGRGAKMLDMFR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctgcatctgcgctagggtgtcgcgagtgctggtttttggtggctgctgtgcgc
aatgaggcgtgtgatacatccctaacgcattggcgcgccctggtcttcgtgcagggggca
ttttccctgctgtttgcgctgttcctcttggttccaatggctgtagacttcttcatgggc
ggagaggattgggagggttttgccactgccttttcggtgtctgctgttgttggatcggtg
tgtctgcactttgggaaatctggccccatagggcggcatgaaaccgtatatctcatctgt
gccgtgtggactgtgctgtcaattctggccgcaataccctttcttgtctcggagacagcc
aagttgtcttatgctgatgcgctgtttgaagctgtgtctgggcttaccaccactggtgcc
acggtgctctataatctacaagcgaaatcgccgggaatactactgtggcgcgtgatgcta
aactttatcggtgggttgggagttatcgccattggtgtgttgctgttaccatgcctgaaa
gttgttgggcttaaggatatctacggcgttgaatccgccacagcgcggcaacggttcaag
ttgagtgttttcagaactgtgctgtacatttcttgcatgtatgctatgttgctagtactg
tgtacgggtgcctacaagatagccggcatgtctgcgtttgatgcaatatgccatgcgatg
agtacggtttccacgggtggttttgcaaattacgacagctcgctgggccacttcaacagc
gctgcaattgagatcgtcgccattgtctttatgctgctgtcttcttgcccgtttgtagtc
tatcttaggttggcgcttgagggcaggtttcgatccaagcagtttgttgtcttcgtgtgc
gtacttgtggtattttcgctattgggtgcggtcaacctatacagcagaaacatgcttccc
gaggcggagtttcctgaggtgctgcgacgctcagccttcatactcgtttcactggtgact
tctaccgggttttctaactgcgactacagctcctggggctttttagccgtttctgggaca
atcctaaccttatgtggaggatgctccggttccactaatagcggccttaaaatgcataga
atagttatcctggtacgcggtggatacagatacgtcaaacacatgctcatgcggactcca
ttcaccgtgtctgagcaatcagcgcgggaggaggccttgcctgaagccggtgcgtttttc
tttttgtatgttttcgtattttgcatcgcatgcattattgttgcctggagtgaagacgac
ttggcaacaattgtaacgtctgtttcatcaacttttacgaatacggggccgggcataggt
gatgttgtcgggccacatggtacgtatgccccggtgtctgcaaccgtcaagtttgtattg
acggtactaatgttgatcggacggctagagctcgttccagtttttgtgcttatactgtct
ctgctgcgaggcggtgcagggcgcttgctggggattggtaggggagcaaaaatgcttgat
atgttccgataa

DBGET integrated database retrieval system