KEGG   Alteromonas macleodii English Channel 673: AMEC673_00555Help
Entry
AMEC673_00555     CDS       T02254                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00230  Purine metabolism
amg01100  Metabolic pathways
Module
amg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AMEC673_00555
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AMEC673_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 AAA_22 ABC_tran AAA_33 DUF815 AAA_16 AAA_18 AAA AAA_30 AAA_29 AAA_19
Motif
Other DBs
NCBI-ProteinID: AFT72817
UniProt: A0A0E0YAX1
Position
126756..127397
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYESNTATPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFNEFDSVIINDDFATA
LNDLEAIVTAQRLRTGKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttattcattcttgcagctccttctggagcaggaaaatca
agccttattaaggcgctaatggaaaagtatgaaagcaatacagctacgccaatgcaggtg
tctgtatctcatacaacacgtcaacctcgtccgggtgaagtcgacggcgtgcactaccat
tttgtgagccgagagcagtttgaagcgctgattgaacagggtgtgttttttgaatacgca
gaagtatttggcaattattacggcacatcccgcgtgacaattgaacaaactttgcaccgt
ggcattgacgtatttttagatatcgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagacacatgcggtattttcattcttccgccttcactcgacgtgctagagcagcgttta
aataatcgcggtcaagacagtgaagaagtcattgcagggcgtatggcgcaagccgtagct
gaaatgtctcatttcaatgaattcgatagtgtaattatcaacgacgactttgcgactgcg
ttaaacgatttggaagccatcgttacagcacagcgacttcgcacgggaaaacaacaaatg
cgccatcaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system