KEGG   Alteromonas macleodii English Channel 673: AMEC673_00555Help
Entry
AMEC673_00555     CDS       T02254                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126756..127397
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYESNTATPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFNEFDSVIINDDFATA
LNDLEAIVTAQRLRTGKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttattcattcttgcagctccttctggagcaggaaaatca
agccttattaaggcgctaatggaaaagtatgaaagcaatacagctacgccaatgcaggtg
tctgtatctcatacaacacgtcaacctcgtccgggtgaagtcgacggcgtgcactaccat
tttgtgagccgagagcagtttgaagcgctgattgaacagggtgtgttttttgaatacgca
gaagtatttggcaattattacggcacatcccgcgtgacaattgaacaaactttgcaccgt
ggcattgacgtatttttagatatcgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagacacatgcggtattttcattcttccgccttcactcgacgtgctagagcagcgttta
aataatcgcggtcaagacagtgaagaagtcattgcagggcgtatggcgcaagccgtagct
gaaatgtctcatttcaatgaattcgatagtgtaattatcaacgacgactttgcgactgcg
ttaaacgatttggaagccatcgttacagcacagcgacttcgcacgggaaaacaacaaatg
cgccatcaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system