KEGG   Alteromonas macleodii English Channel 673: AMEC673_00970Help
Entry
AMEC673_00970     CDS       T02254                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMEC673_00970
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMEC673_00970
   00600 Sphingolipid metabolism
    AMEC673_00970
Enzymes [BR:amg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMEC673_00970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218945..221074)
Genome map
AA seq 709 aa AA seqDB search
MSSLTSFVRLSNEKATLIFDCQGRMPKVIYYGAPLSDSTTPEMLSVLNTRQEAKCAPVIE
PPITLVPTHGDGWTGQPGLEVSGDADQWSAGFSLTEINEDAQSVAFVSEDARRGMRLITT
VELNNKTSVVKYVSRLENSGKTPLNLGYLNAASLPLPTSVSKIKTFEGRWSAEFQTKDHD
LFFGSYVRENRRGKTSHDTFPGLIAFPQGTGELNGECYGYHLGASANHKLRAELMADGRS
YVQFGELLFPGEVVLNAGESYTSPVLYTGYGCEGFSSLSQQFHNFIRSNVLNHSAESKPR
PVHYNTWEGIYFDHNEDELKALADKVAPLGIERFVLDDGWFKGRRNDKAGLGDWFVDEAI
YPEGLDGLIDHVTGLGMEFGIWFEPEMVNPDSDLYRAHPEWALQTENNPHVPFRNQYVLD
LTNPEVVEYLYKVITDVLKAYPKISYIKWDMNRDVNHPGNLHGKPAMHGQMAALYSLIDR
VKAAKPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGCSYFFPAEVMGA
HVGPRDCHITGRHLPIEIRSAVALFGHMGIEMDPRELTDHEQSVLTDAISLYKKYRHITH
GGDLFRMDDDGMNVKFGYVSKDKQEGIFAYNSVLETVRTTPNRFYFAGLDANKQYTIERV
WPEKLKEYTPSILQQTDGQVFSGEVLMKYGMQLPVLFPQTALIYTVKAV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactcacatcattcgttcgtttgtcgaacgagaaagccacattaatattcgac
tgccagggtcgtatgcccaaagtcatttactatggtgcgccattaagtgacagtacaaca
ccagaaatgctgagcgttttaaacacccgtcaagaagccaaatgcgcacccgtaattgaa
ccgccgattacgttggtaccgactcacggtgacggatggacgggtcagccaggtcttgaa
gtgtcgggcgatgccgaccagtggtcagcaggctttagcctgaccgaaataaatgaagat
gcacagtctgttgctttcgtaagcgaagacgctcgccgcggtatgcgtcttatcacaact
gttgagctcaataacaaaacgagcgtagtaaaatacgtttctcgtctcgaaaacagtggc
aaaacaccgctcaatttaggctatttgaatgccgctagcctgcccttgcctacttccgta
agcaaaattaaaacatttgaaggccgctggtcagcagagtttcaaaccaaagatcacgat
ctcttctttggaagttatgtacgtgaaaatcgccgaggcaaaacatctcacgacaccttc
cctggtctgattgcattccctcaaggcacgggtgaacttaacggtgagtgctatggctat
caccttggcgcttctgcaaaccacaagcttcgcgccgagcttatggctgatggcagaagc
tatgtgcagtttggtgagttattatttccaggtgaagtggtacttaacgctggcgaaagc
tatacatcccccgtgctttacacaggctatggctgtgaaggtttctcttcgctatcacaa
cagttccataacttcattcgcagcaacgtgctaaaccacagtgctgaatcgaagcctcgc
ccagtacactacaacacctgggaaggtatttatttcgatcataacgaagatgaacttaaa
gccttagccgataaagttgcaccactgggaattgagcgctttgtgttagatgatggttgg
tttaaagggcgcagaaacgacaaggctgggcttggcgactggtttgttgatgaagctatc
taccctgaaggactagacgggctcattgaccatgttactggccttggcatggaattcggt
atttggtttgagccagagatggtaaaccccgacagtgacctgtaccgcgcacatcctgag
tgggcgctgcaaaccgagaataaccctcacgttcctttcagaaatcagtacgtattggat
ttaaccaaccctgaagtagttgagtacctttacaaagtgattactgatgtactgaaggcg
taccccaaaatcagctacatcaaatgggacatgaaccgcgacgtaaaccaccccggcaac
cttcacggtaaacctgcgatgcatggtcaaatggctgcgctttacagcttaatagaccgc
gtcaaggcagctaagccaggcattgagatagaaagctgttgttcaggcggcggccgtgta
gatttaggtattttgccacacacagatcgtttctggacgtcggattctaacgacgcacta
gaccgtttgtatattcagcgtggttgttcttatttcttcccggctgaagtaatgggcgca
cacgttggcccgcgcgactgccatataacgggtagacacttacctattgagatacgttcg
gcagtagccttgtttggccatatgggtatagagatggacccacgtgaacttactgaccac
gagcaaagcgtgcttactgatgctatttcactttacaaaaagtatcgtcatatcacccac
ggcggcgatctattccgcatggacgatgacggcatgaacgtaaaatttggttatgtatct
aaagacaagcaagaaggtatttttgcatataacagcgttttggaaactgttcgcactacg
ccaaaccgcttctactttgcaggtcttgatgctaataaacaatacaccattgagcgtgta
tggcctgaaaagctaaaagaatacaccccgtctattttgcaacaaactgatggccaagta
ttctcaggtgaagtattgatgaaatacggcatgcagctgccggtattgttcccgcaaact
gcactaatttataccgttaaagcggtatag

DBGET integrated database retrieval system