KEGG   Alteromonas macleodii English Channel 673: AMEC673_01270Help
Entry
AMEC673_01270     CDS       T02254                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291500..292546
Genome map
AA seq 348 aa AA seqDB search
MPIKVLVVDDSALIRQILSEIVTRDPGLTLVGAAPDAYAAKRMVQEFRPDVITLDIEMPK
VDGLRFLEVMMKAMPTPVVMISTLTERGADATLRALELGAVDFMAKPKLGVAQGMAEYAA
VIVEKIKAAAHSRLGQPTQTRCTKHASMRYTGTEKLIGIGASTGGTEAIKDVIMHFPRNA
PATIISQHMPPGFTTTYAKRLDSLCEITVREAHGGERLLPGFAYLAPGNKHLKVERSGAD
YRLTLDDGPKVSGHKPSVDVMFDSLAEHAGANAVGVLLTGMGRDGAKGLKSMHTKGSVTF
CQDEKTCVVYGMPKVAVEMKAASFIKPLEDISDAILDTLEALGAGSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaagtcctcgtagttgatgactctgcgttaatccgccaaatcctttcagaa
atagtaacccgagatccaggtttaacgcttgtgggtgcggcgccggatgcttatgcggcg
aagcgaatggtgcaagagttcaggccagacgttattactctggacattgaaatgccgaag
gtagacgggttacgttttttagaagtaatgatgaaggcgatgccgactccagttgtgatg
atatctacgctgactgaaagaggtgccgacgcaacactgcgtgcgctcgaactaggcgct
gtggattttatggcaaagccaaagctcggcgtagcgcaaggtatggctgaatacgcggcg
gttattgttgaaaagataaaagcagcagcgcattcgaggttaggccaaccaacgcaaaca
cgctgcacaaaacatgcttctatgcgctacacaggaaccgaaaagttaattggtataggc
gcatcaactgggggaactgaagcaataaaagacgttattatgcattttccccgcaatgca
ccggccaccattatttcccaacacatgcctccagggttcacaaccacctacgccaagcgg
ctcgatagcctttgtgaaataaccgtgagagaagcgcacggaggggagcgtttattgcct
ggatttgcgtacttggcaccaggtaataaacatttaaaagtagagcgtagcggcgctgac
tatcgtttaacccttgatgatggccccaaggtatcgggacacaagccctccgttgatgtg
atgtttgactcgctggctgagcatgctggcgcaaacgcggtgggtgtgctgcttacaggc
atgggacgggatggagcaaaaggccttaagagtatgcacacaaaaggctctgttacgttt
tgtcaggatgaaaaaacctgcgttgtttacggtatgcctaaagtggctgtagaaatgaaa
gccgcgagttttatcaagccgttagaagatatctcagatgcaattctagatacgctagaa
gcattgggcgcgggctcgcgcctttaa

DBGET integrated database retrieval system