KEGG   Alteromonas macleodii English Channel 673: AMEC673_01270Help
Entry
AMEC673_01270     CDS       T02254                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amg00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMEC673_01270
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AMEC673_01270
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AMEC673_01270
Two-component system [BR:amg02022]
 CheA family
  CheA-CheYBV
   AMEC673_01270
Bacterial motility proteins [BR:amg02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AMEC673_01270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291500..292546
Genome map
AA seq 348 aa AA seqDB search
MPIKVLVVDDSALIRQILSEIVTRDPGLTLVGAAPDAYAAKRMVQEFRPDVITLDIEMPK
VDGLRFLEVMMKAMPTPVVMISTLTERGADATLRALELGAVDFMAKPKLGVAQGMAEYAA
VIVEKIKAAAHSRLGQPTQTRCTKHASMRYTGTEKLIGIGASTGGTEAIKDVIMHFPRNA
PATIISQHMPPGFTTTYAKRLDSLCEITVREAHGGERLLPGFAYLAPGNKHLKVERSGAD
YRLTLDDGPKVSGHKPSVDVMFDSLAEHAGANAVGVLLTGMGRDGAKGLKSMHTKGSVTF
CQDEKTCVVYGMPKVAVEMKAASFIKPLEDISDAILDTLEALGAGSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaagtcctcgtagttgatgactctgcgttaatccgccaaatcctttcagaa
atagtaacccgagatccaggtttaacgcttgtgggtgcggcgccggatgcttatgcggcg
aagcgaatggtgcaagagttcaggccagacgttattactctggacattgaaatgccgaag
gtagacgggttacgttttttagaagtaatgatgaaggcgatgccgactccagttgtgatg
atatctacgctgactgaaagaggtgccgacgcaacactgcgtgcgctcgaactaggcgct
gtggattttatggcaaagccaaagctcggcgtagcgcaaggtatggctgaatacgcggcg
gttattgttgaaaagataaaagcagcagcgcattcgaggttaggccaaccaacgcaaaca
cgctgcacaaaacatgcttctatgcgctacacaggaaccgaaaagttaattggtataggc
gcatcaactgggggaactgaagcaataaaagacgttattatgcattttccccgcaatgca
ccggccaccattatttcccaacacatgcctccagggttcacaaccacctacgccaagcgg
ctcgatagcctttgtgaaataaccgtgagagaagcgcacggaggggagcgtttattgcct
ggatttgcgtacttggcaccaggtaataaacatttaaaagtagagcgtagcggcgctgac
tatcgtttaacccttgatgatggccccaaggtatcgggacacaagccctccgttgatgtg
atgtttgactcgctggctgagcatgctggcgcaaacgcggtgggtgtgctgcttacaggc
atgggacgggatggagcaaaaggccttaagagtatgcacacaaaaggctctgttacgttt
tgtcaggatgaaaaaacctgcgttgtttacggtatgcctaaagtggctgtagaaatgaaa
gccgcgagttttatcaagccgttagaagatatctcagatgcaattctagatacgctagaa
gcattgggcgcgggctcgcgcctttaa

DBGET integrated database retrieval system