KEGG   Alteromonas macleodii English Channel 673: AMEC673_01925Help
Entry
AMEC673_01925     CDS       T02254                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMEC673_01925
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AMEC673_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453999..454976
Genome map
AA seq 325 aa AA seqDB search
MNWTFTSENNLASTFATYINPFWQNSVTQGHFSGKDNIKVRFAHCIPESPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTRDPQHGYVADFDDYVDDFVMFVET
IVKPLQQGPLQLVCHSMGGAIGALTLLRLPNLFSKAVLASPMFGIKPALPNWLANGLIRT
GLAVNRMKKKDAGYFFGQTPYIAFPFSLNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIENSARAITTPSLVLSADDDAIIDNNRQRRVAQLMPNAKLEIVPRAYHEL
FTESDDIRERSVARILDFLTEDSST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacgttcacgtctgaaaataacttagccagcacttttgccacgtatatcaat
cccttctggcaaaacagtgttactcagggccacttctctgggaaagacaatatcaaggta
cgctttgcgcactgtatcccagaatcgccgcgagctaccattgtaatatgctctggtcga
atcgaatcttatttaaagtacaaagagttcatttacgatctctatcaaaatggtttcgcc
gtattcatcttagatcacagaggccaaggtttgtcagacaggatgacccgtgaccctcag
catggttatgttgccgattttgacgactacgttgatgacttcgttatgttcgtagaaact
attgtaaagccactgcagcaaggcccgttacagctggtatgccattcgatggggggcgcc
attggtgcactcacgctgctgcgtcttccgaatttgttttcaaaagccgttttagcttca
cccatgtttggcattaaaccggctctgcccaattggttggcgaatggcttaattcgcaca
ggccttgcggtaaacaggatgaaaaagaaagatgcggggtacttttttggtcaaaccccg
tatatcgcgtttcctttttcacttaataagctcacccacagcaaaacccgctatgcccta
tttcgtgaactgtatgacgaagagcaggatattcagcttggtggcgtgactacagagtgg
ttggcagcggcacatcaggctatgaacaaaattgaaaatagcgcacgcgctattacaacg
ccctcgcttgtattaagtgcagacgatgacgcgattattgataataaccgtcagcgccgc
gtggctcagcttatgccaaatgcaaaacttgaaatagtgccccgcgcttaccatgagcta
ttcaccgagtctgacgatattcgcgagcgctctgtggcgcgtattctcgactttttgaca
gaagactcgtctacataa

DBGET integrated database retrieval system