KEGG   Alteromonas macleodii English Channel 673: AMEC673_02100Help
Entry
AMEC673_02100     CDS       T02254                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMEC673_02100
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AMEC673_02100
Exosome [BR:amg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMEC673_02100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492552..493562
Genome map
AA seq 336 aa AA seqDB search
MTSSPFPQRRMRRLRAKDALRGLVAEHRLTTDDLIYPVFVLPGENAREAVPSMPGVERLS
IDLLVPETAKWVELGIRTIALFPVTPMSLKTECASEAFNPEGLAQQAMRALKKAFPEVML
MSDIALDPFTSHGQDGLLDETGYVMNDETVEVLIKQALSHAEAGADIVAPSDMMDGRIGS
IRKALEEAGHINTCIMAYSAKYASAYYGPFRDAVGSAANIKGGNKKTYQMDPANTDEALH
EIALDIEEGADMVMVKPGMPYLDVVRRCKDEFKVPTFAYQVSGEYAMHQAAFANGWLNED
AVILESLLAFKRAGADGILTYFAPQAAALLAKQNDK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcacctttccctcaaagaagaatgcgcagactacgcgccaaagatgcttta
agagggcttgtggcagagcaccgtttaaccactgacgatctcatttaccctgtttttgta
ctacccggtgagaacgcacgagaagccgtaccttctatgcctggtgtggaaagactttct
atcgatttgctagtgccagaaacggcgaaatgggtagagctgggcattagaacgattgcg
cttttccctgtgacacctatgtctcttaaaaccgagtgtgcaagcgaagcgttcaatcct
gaagggcttgctcagcaagctatgagagcgcttaaaaaggcgtttcctgaagtaatgctg
atgtctgatatcgcattagatccatttacgtctcatggtcaagatggcctcttagacgaa
actggttatgtgatgaacgacgaaacagtcgaggtgctcattaagcaagcgttatcgcat
gctgaagctggcgctgatattgttgcgccttctgacatgatggatgggcgcattggcagt
atccgaaaagcacttgaagaagcaggtcacatcaatacgtgtattatggcttattctgct
aaatacgcgtctgcgtactacggtccatttcgtgatgccgtcggctccgctgcaaatata
aagggcggcaacaagaaaacctatcaaatggatcctgccaacaccgatgaagctctccac
gaaattgcgcttgatatagaagagggcgctgacatggtaatggtgaagccaggtatgccg
tatttagatgttgtgcgtcgttgtaaagacgaatttaaagtaccgacattcgcctatcaa
gtaagtggcgagtacgctatgcatcaagctgcttttgctaatggttggctaaatgaagac
gcggtgatcctagaatcgttattagcgtttaagcgcgctggcgccgacgggattctgact
tatttcgctccgcaagctgctgcgcttttagcgaagcaaaacgacaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system