KEGG   Alteromonas macleodii English Channel 673: AMEC673_02230Help
Entry
AMEC673_02230     CDS       T02254                                 

Definition
beta-hexosaminidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMEC673_02230
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AMEC673_02230
Enzymes [BR:amg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMEC673_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523858..525831
Genome map
AA seq 657 aa AA seqDB search
MLFQQVICKKRASLMGLSAILSGILILLSASLFTASATAQSESANASNNPKPSADAETIR
AVKNMLGQKIILDFRYFCEDNTPSSRCRTPMTVIPPSLLNVLSTHNIGGVILFSENIQNT
EQLITLNYTMQQHMVKAGRQPLFIAVDQEGGRVARLPSDMLSPFAGNMAIGATFHQRGSA
FAQSVASHIGQTLLPLGINTNFAPSVDVNSEPKNPVINVRSFSENPEQVAALGQTFVSAM
QSTGVMSAIKHFPGHGDTHVDSHSGLPQVMHSKAQAMAGDILPFANIINSATPPAMVMSA
HIQYPSLDDTTIIDKHGKSQIVPATLSKKILSNLLRNQLGYQGLIVTDALDMAGITQFFS
HEEALVSAFSAGADIALMPFTIRTQDDIKKFALLLDNAASRMSESAFLKASHNRIIKAKQ
RFALQSFISKPMSWWLNEAKENASMNNPNSLKNRGIQIEKALSKSSVSVLFGKDELPITS
NRWLALMPDAARCLAFEAALTRARSNFNNKTLEFACLPLTALPKTQLAMNLLKQADVLVV
GNISPLHANYELGGVDLPEHVKRRASETEVMAFSKKIMVAAKAQNKTVVFAPLRMPYKAH
DVKELADVAIATFSYAVNITQQSDKENQHVTSYSLNALVDVILGSALAEGRSPVSLK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
ttgttattccagcaagttatttgtaaaaaacgtgcttcattgatgggccttagcgctatc
ttgtcaggcatactcattttattaagtgcttcactgtttactgctagcgcaaccgcgcaa
tctgaaagtgctaacgcttcgaataatcctaagcccagcgctgatgccgaaacaattcgc
gctgtaaaaaacatgctcgggcaaaaaatcattttggattttcgctatttctgtgaagac
aatacgccgtcttcgcgctgccgtacgcccatgaccgtaattccaccgtcacttttaaat
gtgcttagtacgcacaacatcggcggtgttattttgttttcagagaacattcaaaatacc
gagcagttaattacgctcaattacaccatgcagcagcatatggtaaaagcaggtcgtcag
ccgttatttattgctgtcgatcaagaagggggcagagtagcaaggttgccttcagacatg
ctctcgccgtttgcgggtaacatggccattggcgccacttttcatcagcgaggcagcgca
tttgcgcaaagtgtggcatcgcatattggccaaacgcttttaccgctgggaataaacacc
aattttgcgccgtcggttgatgtaaatagcgagccgaagaaccccgttattaacgtacgc
agcttttcggaaaatccagagcaggtagccgcactcgggcagacatttgtcagtgctatg
caaagtactggtgtaatgagtgctatcaaacattttccaggccatggtgatacccatgta
gatagccacagtggcttgccgcaagtaatgcatagcaaagcgcaagctatggcgggtgac
atccttccttttgcgaatatcattaatagtgcaacgcctcctgcaatggtaatgagtgca
cacattcagtacccgtctttagacgatacgacaattattgataagcatggtaagtcacaa
atagttcctgctactttgtcgaagaagatactaagcaatttgcttcgcaaccaattagga
tatcaaggccttatcgttactgacgcgttagacatggcaggtattactcagtttttctcc
catgaagaagcattagtcagtgcattcagcgcaggtgctgacattgcgcttatgccgttc
accataagaacccaagacgacataaaaaagttcgcgttacttttggataatgcagcaagt
cgaatgtcagaaagcgctttcttgaaagcgtctcataatcgtattattaaggcaaaacag
cgctttgctttgcaaagttttatttccaagcccatgtcatggtggctcaatgaagcgaaa
gaaaatgcttcaatgaataaccctaacagtttgaaaaacagaggaattcaaattgagaaa
gcgctttctaaatcgtcggtatctgtactcttcgggaaggatgagttgccaataacttca
aatcgctggttggcgcttatgccagacgcagcaagatgtttagcatttgaagccgcgctt
acacgcgcacgttccaacttcaacaataagactctggagtttgcgtgtttgccgttaact
gcgttacctaaaacccaattagcaatgaatctactaaaacaagctgacgtgctggtggtt
ggtaatattagtccgctacatgctaactatgaattaggaggagtcgatttacctgagcat
gtgaaacgacgcgcaagcgagactgaggtgatggcatttagcaaaaaaataatggttgct
gcgaaagcacagaataaaaccgtggtctttgctccactgcgcatgccatataaagcgcat
gacgtgaaagagctagccgatgttgctattgctacatttagttatgcggtgaacattaca
cagcaaagtgataaagaaaatcagcacgttacgagctatagtcttaatgctttggttgat
gtaatacttggtagcgcgctcgctgagggacgttcacctgtttcgttgaaatag

DBGET integrated database retrieval system