KEGG   Alteromonas macleodii English Channel 673: AMEC673_02590Help
Entry
AMEC673_02590     CDS       T02254                                 

Definition
(GenBank) dihydrofolate reductase type I, trimethoprim resistance
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00670  One carbon pool by folate
amg00790  Folate biosynthesis
amg01100  Metabolic pathways
Module
amg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMEC673_02590
   00670 One carbon pool by folate
    AMEC673_02590
Enzymes [BR:amg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AMEC673_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AFT73219
UniProt: A0A0E0Y7Y2
Position
591387..591884
Genome map
AA seq 165 aa AA seqDB search
MIAAMAKNRIIGADNDMPWHLPADLKHFKAITLGKAVIMGRKTYESIGRALPGRPNIVIT
SNTDYSLSDATVVDSPESAIEVAKALSAEHSDNDEIMIIGGGTIYQTFLDSTDTLYLTHI
DLTVDGDTQFPDYEAAASWTEVSRDEHDADEKNPHPYTFVTLVRN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgctatggcgaaaaacagaattataggcgcagataatgatatgccgtggcac
ttaccggctgatttaaaacactttaaagcgatcaccttaggcaaagccgtcataatgggc
cgcaaaacctatgagtcaatcggaagggcattacctggcaggccaaacattgttataacg
agtaatactgactacagcttatctgacgcgacggtagtagattcaccagagtcagcgatt
gaggtagccaaagcgctaagcgcagagcacagcgacaacgatgaaataatgattatcggt
ggcggtactatttaccaaacgttcttagatagcactgacactttgtatctcacacatatt
gatttgactgttgacggagatacacagttcccagactatgaggcggcagcaagttggacg
gaagtatcacgtgatgaacatgacgccgatgagaaaaatcctcacccttacacattcgtt
actctcgttcgaaactaa

DBGET integrated database retrieval system