KEGG   Alteromonas macleodii English Channel 673: AMEC673_03420Help
Entry
AMEC673_03420     CDS       T02254                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amg  Alteromonas macleodii English Channel 673
Brite
Enzymes [BR:amg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AMEC673_03420
Secretion system [BR:amg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AMEC673_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797411..798214
Genome map
AA seq 267 aa AA seqDB search
MERYRFKQLHVKPVSTSELKWQNGEYLVKAVKKVLLASVVAAGSLLGLSAQAADEAAIRD
KLTSMLGLDVETIADSPVSGLVQVSTNRGLFYVSENGQYLLQARVFNIDEEMRNETELAL
SGLRKEGVKEMESSSITFKAKNEKHEISVFTDITCGYCRKFHKEIDELNDAGITVHYLAF
PRSGLNSENYNDMVSVWCAKDPQKALTKAKAGNDVASASCKNKVAEQYMLGQKLGVNGTP
NIVLPDGSLIPGYQPAALLAKALEEAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaaagataccgattcaagcagttgcatgttaagccagtaagtacaagcgaacttaaa
tggcaaaatggagagtatttagtgaaagcagtaaagaaagtattgttagccagtgtagtt
gcggcaggttctctattagggcttagtgcgcaagcggctgatgaagcggctatccgtgat
aaattaacctcaatgctagggttagatgtagaaactattgctgactctccagtatcaggg
ctggttcaggtatcaacaaaccgcggtttattttacgtaagtgaaaacgggcagtatctg
cttcaggctcgtgtttttaacattgatgaagagatgcgtaacgaaacagagctggcactt
tctgggctgcgcaaagaaggcgtaaaagagatggaatcatcgtctattacgtttaaggcc
aaaaacgaaaagcatgaaataagcgtatttactgatattacgtgtggttactgccgtaaa
tttcacaaagagattgatgaactaaacgatgcgggcatcaccgtacactaccttgcgttt
ccacgttctgggttaaacagtgaaaactacaacgatatggtgtcggtgtggtgtgcgaaa
gacccgcaaaaagcgttaactaaagctaaagcgggtaacgacgtagctagcgcaagctgt
aaaaataaagtggcagagcagtacatgttaggtcaaaaattaggcgtgaatggcacgcca
aatatcgtactgccagacggttcattgattcctggttatcagccagctgcgttgcttgct
aaagcattggaggaagctgaatag

DBGET integrated database retrieval system