KEGG   Alteromonas macleodii English Channel 673: AMEC673_03420Help
Entry
AMEC673_03420     CDS       T02254                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amg  Alteromonas macleodii English Channel 673
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797411..798214
Genome map
AA seq 267 aa AA seqDB search
MERYRFKQLHVKPVSTSELKWQNGEYLVKAVKKVLLASVVAAGSLLGLSAQAADEAAIRD
KLTSMLGLDVETIADSPVSGLVQVSTNRGLFYVSENGQYLLQARVFNIDEEMRNETELAL
SGLRKEGVKEMESSSITFKAKNEKHEISVFTDITCGYCRKFHKEIDELNDAGITVHYLAF
PRSGLNSENYNDMVSVWCAKDPQKALTKAKAGNDVASASCKNKVAEQYMLGQKLGVNGTP
NIVLPDGSLIPGYQPAALLAKALEEAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaaagataccgattcaagcagttgcatgttaagccagtaagtacaagcgaacttaaa
tggcaaaatggagagtatttagtgaaagcagtaaagaaagtattgttagccagtgtagtt
gcggcaggttctctattagggcttagtgcgcaagcggctgatgaagcggctatccgtgat
aaattaacctcaatgctagggttagatgtagaaactattgctgactctccagtatcaggg
ctggttcaggtatcaacaaaccgcggtttattttacgtaagtgaaaacgggcagtatctg
cttcaggctcgtgtttttaacattgatgaagagatgcgtaacgaaacagagctggcactt
tctgggctgcgcaaagaaggcgtaaaagagatggaatcatcgtctattacgtttaaggcc
aaaaacgaaaagcatgaaataagcgtatttactgatattacgtgtggttactgccgtaaa
tttcacaaagagattgatgaactaaacgatgcgggcatcaccgtacactaccttgcgttt
ccacgttctgggttaaacagtgaaaactacaacgatatggtgtcggtgtggtgtgcgaaa
gacccgcaaaaagcgttaactaaagctaaagcgggtaacgacgtagctagcgcaagctgt
aaaaataaagtggcagagcagtacatgttaggtcaaaaattaggcgtgaatggcacgcca
aatatcgtactgccagacggttcattgattcctggttatcagccagctgcgttgcttgct
aaagcattggaggaagctgaatag

DBGET integrated database retrieval system