KEGG   Alteromonas macleodii English Channel 673: AMEC673_04460Help
Entry
AMEC673_04460     CDS       T02254                                 

Definition
(GenBank) putative glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00040  Pentose and glucuronate interconversions
amg00052  Galactose metabolism
amg00500  Starch and sucrose metabolism
amg00520  Amino sugar and nucleotide sugar metabolism
amg01100  Metabolic pathways
amg01130  Biosynthesis of antibiotics
Module
amg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMEC673_04460
   00052 Galactose metabolism
    AMEC673_04460
   00500 Starch and sucrose metabolism
    AMEC673_04460
   00520 Amino sugar and nucleotide sugar metabolism
    AMEC673_04460
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AMEC673_04460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD AstB
Motif
Other DBs
NCBI-ProteinID: AFT73589
UniProt: A0A0E0Y8W2
Position
1036040..1036933
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDAASNPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGESAKIHKMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLASVVK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcgggccttgggacgagaatgctccca
gcaacgaaagctattccaaaagagatgttgccagtggttgataagccattgatccaatac
gtggtaagcgaatgtgttgctgcaggactaaaagaaattatcctagtaacgcacgcgagt
aaaaacagtattgaaaaccactttgatacctcttttgagctagaagccacactagaaaag
cgtgtaaaacgccaactgttagaagaagttcagtcaatctgtccaaaagatgtaactatc
atgcatattcgccaaggcgttgcgaatggacttggtcacgcagtactttgcgctcgacct
ctgattggcgatgcgccatttgcggtagtgttacctgacgtcattattgatgatgcagca
agtaatcctaaaaaggataaccttgcagacatggttgccaaatttaacaccagccgagta
agccaggtcatggttgagcaggttccagacgaagatatctctaaatttggtatcgcagac
ctagacggcgcggcaattgcgccaggtgagtcagcgaagattcacaaaatggtagagaag
ccgcctcgcgacgaagcaccttctgaccttgccgttgtaggccgatacgttctgtcagaa
aaaatctgggatctgttagagttcacgcctccaggcgcaggtggtgaagttcagcttact
gatgctattgatgcattgatgaaacttgaacaagttgatgcctactacatgaaaggtaag
agtcacgattgcggtagtaagttggggtacatgaaagctaacgttgaatatgcgttacgt
catccatcgttaggcgacgaatttaaagaatacttagcttctgttgttaaatag

DBGET integrated database retrieval system