KEGG   Alteromonas macleodii English Channel 673: AMEC673_04590Help
Entry
AMEC673_04590     CDS       T02254                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:amg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061987..1063174
Genome map
AA seq 395 aa AA seqDB search
MQTVTVLGATGSIGCNTLDVINRHPDKYRVFAITGNSQLELLMEQAQKCAPRYVVIADDA
NYKLACELASQYGVDAEILAGAKALEEVSSAPEVDAVMAAIVGAAGLLPTLAAVKAGKRV
LLANKEALVMSGALFIEAANQSGAEILPIDSEHNAIFQCLPHDYEYGNFAASGIRKILLT
GSGGPFRERPLDSFSSITIDEASTHPNWSMGRKITIDSATMMNKGLEFIEACWLFGAGAD
DIDVVIHPQSIIHSMVQYVDGSVIAQMGNPDMRTPIAYGLAHPERIEAGVTPLDFSDIGN
FSFQTPCFERYPNLKLAIDACKEGQCATTRVNASNEVAVEAFLEGKIQFCDIAKVNDATL
NAMPNVSVNSIQQILEQDSLARAKANEIIRGKFQC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagtaacagtgttaggggccacaggctccattggttgtaatacactcgacgta
ataaatcgccacccagacaaatatcgcgtatttgctattactggcaactcacagcttgaa
ttgcttatggagcaggctcagaaatgcgcgccgcgctatgtggtaattgctgatgacgct
aactacaaacttgcctgtgagttagcatcccagtacggtgtggatgcagaaattctcgct
ggtgctaaggcgctggaagaagtatccagcgcgccagaagttgatgctgtaatggcagcc
attgtgggtgcagcagggcttttacccacactggcagcagtaaaggcgggtaaacgggtt
ttgcttgccaataaagaagcgttagtcatgtctggtgctttatttatcgaggctgcgaac
caaagcggcgctgaaattcttcctatcgacagcgaacacaacgccatattccagtgccta
ccgcacgattatgaatacggtaactttgctgcatccggcattcgtaaaattctcttaacg
ggttctggtggtccgtttagagaaagaccgcttgatagcttctcgtcaattacaatcgat
gaagccagtacacaccctaactggtcgatgggcagaaaaattacaatcgactctgcaact
atgatgaacaaggggctggagttcattgaagcctgttggttgttcggtgctggtgcagat
gatattgatgtggttattcacccgcaaagtattattcattctatggtgcaatatgttgat
ggctcggtgatcgcacaaatgggcaatcctgacatgcgtacccctattgcttatggtttg
gcgcaccctgagcgaattgaagcgggcgtgacgccgctcgacttttctgacattggcaat
ttcagttttcaaaccccttgctttgaacgttatccgaatttgaagctggctattgatgcg
tgtaaagaagggcaatgtgcaacaacgcgagtgaatgcgtctaatgaagtggctgtcgaa
gcctttttagaaggcaagattcagttttgtgatattgctaaagtaaatgacgccacgctt
aatgctatgcccaatgtgtcggtgaattctattcagcaaatactagagcaagacagcctt
gcaagagcaaaagctaacgagattattcgaggtaaattccagtgctag

DBGET integrated database retrieval system