KEGG   Alteromonas macleodii English Channel 673: AMEC673_05800Help
Entry
AMEC673_05800     CDS       T02254                                 

Definition
PAP (3,5 adenosine diphosphate) 3 phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:amg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1363910..1364701)
Genome map
AA seq 263 aa AA seqDB search
MTQPLNSLAQKVLAIAKEAGDKIMAIYEKDFAIYEKQDTSPLTEADLAAHNVIVNALEAE
SDLPILSEESADISWEERKTWSSYWLVDPLDGTKEFIKKNGEFTVNIALIENGKPTMGVV
YAPALNKSYVGIVGEGAWTEVNGEFTAISARKHDGAEVWKVVGSRSHQSPEIQNLLAQLK
GETELVAMGSSLKLCLVAEGEAHLYPRLGPTSEWDTGAAHAVALAAGANVTVLDPENPLD
DNADALTYNQKESVLNPFFLVSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctttaaatagtcttgcacagaaagtgctagctatcgccaaagaagccggc
gataagataatggccatttacgagaaagacttcgccatttatgaaaagcaggataccagc
ccgctaacagaagctgaccttgccgcacataacgtaatcgttaacgcccttgaagctgaa
tctgacctgccgattctttctgaagagtcagcagatatttcatgggaagagcgcaaaacg
tggtcgtcatactggctggtagacccgctagacggcactaaagagtttattaagaaaaac
ggtgagtttacggtaaatattgcacttatcgaaaacggtaaaccgaccatgggtgtggtt
tacgcgccagcactaaacaaaagctatgtaggtattgttggtgaaggtgcgtggactgaa
gtaaatggcgaatttaccgctatttctgcgcgcaagcacgatggtgccgaagtgtggaaa
gtggtaggtagtcgttctcaccaaagcccagaaattcagaatttattggcacagcttaaa
ggtgaaaccgagcttgtggcgatgggtagctcactgaagctttgcttggtggctgagggc
gaagcacatctttaccctcgattaggcccaacatctgaatgggatacaggtgcagcgcac
gcagtcgcactcgcagcaggcgcaaacgtcaccgtacttgaccctgaaaacccattagat
gacaacgctgacgctcttacgtacaaccaaaaagagtctgtgttaaacccctttttcctt
gtgagcgcataa

DBGET integrated database retrieval system