KEGG   Alteromonas macleodii English Channel 673: AMEC673_06120Help
Entry
AMEC673_06120     CDS       T02254                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AMEC673_06120
Enzymes [BR:amg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AMEC673_06120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444599..1445219
Genome map
AA seq 206 aa AA seqDB search
MIGRIRGTLAEKQPPEILVDVAGVGYEIHMPMTSFYQLPAVGEEVVVYTHFVVREDAQLL
FGFADKMERGLFRELIKANGVGPKLGLAILSGMSASQFLASVQNEDVSALVSLPGIGKKT
AERLVVELKDRLAKFGKAQSIAVPPPSGDLLSTNTIVAVNDAREEAQSALIALGYKPAQA
SKLVDSVYKEGMESEALIRESLKAAI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgaattcgcggtacgttggctgagaaacagcctccagaaattcttgtagat
gtagccggtgttggctacgaaattcacatgcctatgaccagtttctaccagcttcccgcg
gtgggtgaagaagtggtggtgtacacacactttgtggttcgtgaagacgcccaattgctg
tttggttttgctgataaaatggaaagagggcttttccgagaattgatcaaagccaatggt
gtaggtccaaaattaggccttgctattttatctggaatgtcggcaagccagttcttggca
agtgtacaaaatgaagatgtttctgcactcgtcagcttaccgggtataggtaagaaaacc
gcagagcgtttagtggtagagcttaaagaccgcctagcaaaatttggtaaggcgcagagt
attgctgtaccgcccccaagtggcgacttgctatccaccaacactattgttgctgtaaac
gacgctcgggaagaagcgcaaagcgcgcttattgcactgggctataaacctgctcaagcg
agcaagctagtcgacagcgtatataaagagggcatggaaagtgaggcccttattcgcgaa
tcattaaaagcggccatataa

DBGET integrated database retrieval system