KEGG   Alteromonas macleodii English Channel 673: AMEC673_06465Help
Entry
AMEC673_06465     CDS       T02254                                 

Definition
lipase/acylhydrolase, GDSL family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AMEC673_06465
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AMEC673_06465
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AMEC673_06465
Lipid biosynthesis proteins [BR:amg01004]
 Fatty acid synthase
  Component type
   AMEC673_06465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524501..1525157)
Genome map
AA seq 218 aa AA seqDB search
MFVKFRYLYAFLLILLIPFQALSDQAEQSDTSENAVLLILGDSLSAAYGLQQHEGWVSLL
QKMWQDDNIPIDIVNAAVSGETTDGGLARFPRLLEQHNPTHVLIELGGNDGLQGHNIGKI
RDNLDSLVSVAKESKAVVFLQEMQIPSNYGKRYTQMFTQNFNKVAEAQDVQKIPFFLEEI
ALNKDLMQNDGIHPNAEAQPLIANFMDRHLRSLILSAQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttaaatttcgttatttgtacgcttttttacttattcttttaataccctttcaa
gcgctatcagatcaagccgagcagagcgacacaagcgaaaatgcggttttacttatctta
ggtgacagtttatccgcggcttatggattacagcaacatgagggttgggtcagtttgtta
caaaagatgtggcaagacgacaacattccgattgatattgtaaatgctgcggtaagcgga
gagactactgacggcggtttagcgcgattcccccgtttattagagcaacacaaccctacc
catgtattgattgaactgggcggtaatgacggccttcagggccataatatcggtaagatt
agggataatttagattcactggtaagtgttgcgaaagagagtaaagccgtagtgtttctg
caagaaatgcaaattccttctaattatggcaagcgctatacgcagatgtttactcaaaac
ttcaataaagtcgcggaagctcaggacgttcaaaaaattccatttttccttgaagaaata
gcgctaaataaggacttaatgcaaaacgatggtattcatccaaatgctgaggcacagcct
ttgatcgctaattttatggacagacacttaagaagtttaattcttagcgctcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system