KEGG   Alteromonas macleodii English Channel 673: AMEC673_06520Help
Entry
AMEC673_06520     CDS       T02254                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00260  Glycine, serine and threonine metabolism
amg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01130  Biosynthesis of antibiotics
amg01230  Biosynthesis of amino acids
Module
amg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMEC673_06520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMEC673_06520
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMEC673_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RsmJ NanE GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFT73999
UniProt: A0A0E0Y9W9
Position
complement(1535339..1536148)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFAGLDEKNQGAFVPFVMVGDPDLAQSEAIICKLIESGADALELGIPYSDPIAD
GPTIQASAIRALESKVTVADCLGVISRVRAKYPEVPIGLLLYSNLVMAQGIENFYNKAQD
AGVDSILIADVPIREAAPFQKAAEATGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGSFVESMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatgcacaaatgtttgcgggccttgatgagaaaaaccagggcgcattcgta
ccgttcgttatggttggcgaccctgatttagcgcaatctgaagctattatttgtaagtta
atagaaagcggtgcagatgcactagagctgggtattccttactctgaccccattgctgat
ggcccgactatccaagcatcggcaattcgcgctttggagagtaaagtaacggtagcggat
tgcttgggtgtaatttcacgggttcgcgcaaaatacccagaggtgcctatcggcttgcta
ctttatagcaacttggtaatggcacagggtatcgagaacttttacaacaaggctcaggat
gcaggcgttgactcaattttgattgccgacgtgccaattcgcgaggcggcaccttttcaa
aaagcagccgaagcaacgggcatttcacaaattctgattgcaccacctaatgctactgac
gaaaccatggaaaaaatcggggaatactcgaaaggttacacgtatttgctgggtcgtgcg
ggcgttactggcgcagaaactgccgcaaatgtgcctgcttcagagcttattgagcgcttg
aacaaacacaaagcagcaccagcattgttaggttttggtatttctacacctgaacaggtg
aaatctgccattgacgctggagccgctggcgcaatctctggttcggcaacagtaaatatc
attgctgctaatttatcggacagtcacaaaatgctaagcgagctcggcagctttgttgaa
agcatgaaagcagctacggcaaaaggataa

DBGET integrated database retrieval system