KEGG   Alteromonas macleodii English Channel 673: AMEC673_06520Help
Entry
AMEC673_06520     CDS       T02254                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMEC673_06520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMEC673_06520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMEC673_06520
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMEC673_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1535339..1536148)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFAGLDEKNQGAFVPFVMVGDPDLAQSEAIICKLIESGADALELGIPYSDPIAD
GPTIQASAIRALESKVTVADCLGVISRVRAKYPEVPIGLLLYSNLVMAQGIENFYNKAQD
AGVDSILIADVPIREAAPFQKAAEATGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGSFVESMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatgcacaaatgtttgcgggccttgatgagaaaaaccagggcgcattcgta
ccgttcgttatggttggcgaccctgatttagcgcaatctgaagctattatttgtaagtta
atagaaagcggtgcagatgcactagagctgggtattccttactctgaccccattgctgat
ggcccgactatccaagcatcggcaattcgcgctttggagagtaaagtaacggtagcggat
tgcttgggtgtaatttcacgggttcgcgcaaaatacccagaggtgcctatcggcttgcta
ctttatagcaacttggtaatggcacagggtatcgagaacttttacaacaaggctcaggat
gcaggcgttgactcaattttgattgccgacgtgccaattcgcgaggcggcaccttttcaa
aaagcagccgaagcaacgggcatttcacaaattctgattgcaccacctaatgctactgac
gaaaccatggaaaaaatcggggaatactcgaaaggttacacgtatttgctgggtcgtgcg
ggcgttactggcgcagaaactgccgcaaatgtgcctgcttcagagcttattgagcgcttg
aacaaacacaaagcagcaccagcattgttaggttttggtatttctacacctgaacaggtg
aaatctgccattgacgctggagccgctggcgcaatctctggttcggcaacagtaaatatc
attgctgctaatttatcggacagtcacaaaatgctaagcgagctcggcagctttgttgaa
agcatgaaagcagctacggcaaaaggataa

DBGET integrated database retrieval system