KEGG   Alteromonas macleodii English Channel 673: AMEC673_07075Help
Entry
AMEC673_07075     CDS       T02254                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMEC673_07075
  Amino acid metabolism
   00300 Lysine biosynthesis
    AMEC673_07075
Enzymes [BR:amg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AMEC673_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1663603..1664739)
Genome map
AA seq 378 aa AA seqDB search
MLNDSVIEIAKQLINRRSVTPEDAGCQEAMGEFLGALGFNNETMVFEDTTNLWSRRGKEG
PVFCFAGHTDVVPSGPESAWKTPPFTATEVDGYLHGRGAADMKGSLAAMLVATREFVNKY
PDHKGSIAYLITSDEEGPFINGTTRVIDTLEARNEKIDWCIVGEPSSTDEVGDIVKNGRR
GSLTGDLVVKGIQGHVAYPHLAKNPVHSAMAALDELAKSHWDNGNDFFPPTSFQISNIHA
GTGAGNVIPGEMHVCFNFRFSTEVTDQVLIERVTAILEAHELEYEIKWTFNGQPFLTDTG
ALLEATQGAIAAVKGTPTVLSTAGGTSDGRFIAPTGAQVIELGPVNATIHKIDECVKMSD
LEQLADMYFGILERLLAK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacgactctgttattgaaattgctaaacaattaataaaccgccgttctgtaacg
ccagaagacgcaggttgccaagaagccatgggcgagtttttaggtgctttagggtttaat
aatgaaaccatggtatttgaagacacgacgaacctttggtctcgcagaggtaaagaaggc
ccggtattttgtttcgcaggccacactgatgtagtgcctagtggccctgagtcagcatgg
aaaacaccgccatttaccgcgacagaagttgacggctatctgcatgggcgcggcgcagct
gacatgaaaggcagtcttgccgctatgctagtagccacccgcgagtttgtgaacaaatac
cctgatcacaagggaagtattgcgtaccttattactagcgacgaagaaggcccttttata
aacggtaccacccgcgttattgatacccttgaagcccgcaacgaaaaaattgattggtgt
attgttggcgaaccctcttcaaccgacgaagtaggcgatattgttaagaatggccgtaga
ggttcattaacgggtgatttagtagtaaaaggtatccaaggccatgtcgcctaccctcat
ttagctaaaaaccctgttcacagtgcaatggcggcccttgacgagctagctaaatctcat
tgggataacggtaacgactttttccctcccaccagcttccagatatcaaacattcacgcg
ggtacgggtgcgggcaatgtgatcccgggcgagatgcacgtttgcttcaacttccgtttt
tcaacggaagtaaccgaccaagttctcattgagagagtcacggcaattttggaagcccac
gaactggagtacgagattaaatggacgtttaacggtcaaccctttttgaccgatacaggt
gccttgttagaggccactcaaggtgcaatagcggcggttaaaggaacacctaccgtgctg
tctacagctggcggtacatcagatggtcgctttatcgcgccaacaggtgcacaagtgata
gagctaggcccggtgaatgccactattcacaaaattgacgagtgcgtgaaaatgtctgat
cttgaacagcttgctgatatgtacttcggtatcttagaacgcttgctggctaaatag

DBGET integrated database retrieval system