KEGG   Alteromonas macleodii English Channel 673: AMEC673_09065Help
Entry
AMEC673_09065     CDS       T02254                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMEC673_09065
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AMEC673_09065
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AMEC673_09065
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AMEC673_09065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2135913..2137022
Genome map
AA seq 369 aa AA seqDB search
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAH
LFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIF
SLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEH
DDAQLLKSVNTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELS
FNMLLAGENPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDASLAGDAEQLTSSEI
IDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENEEFAHEFEEKTGPIISD
QHIANLEKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatccaaattggaaacgcgtagtcatcaaagtgggtagtgcattgatatcgccc
aaccaacaaggttgtagcagtcattaccttttgagcattgcgcaatttatcgtgcgatgc
agagccaacggtacacaagttgtactcgtgtcttctggttctgtcgcagcaggcgcgcac
ctgtttccagagcaagaaaagtcagatattgcagttaaaaaagcaatggcagcagcgggt
caaaccgaaatgattgccacgtgggacagactgtttgattttccgtctgctcagatgctt
ttaacgcatgctgatttgcgagacagagagcgttacgtaagtatccgtgaaacgatattc
agtttattggataacaatatcctgcctatcgttaacgaaaacgacaccgttaccaccgac
aaattgaaagtgggtgataacgataatttatcggccatggtggcgtcggcagctgaagca
gatgcacttatcatctgttcagacattgatgggttgtacgataaaaacccgcatgaacac
gacgacgcacaattgcttaaatcagttaataccattgatcaaagcatttatgacatggct
ggcggtgcggtaaaaggcggtgtaggcaccggtggtatgcgcactaaaattgaagcggcc
gaaaaagccgtttcgcatggtatagatacatatattattaacggctttactgaactgtcg
tttaatatgctgctagcaggtgaaaacccaggcacgcatttcaaacctcacgccaagcca
atgcaagagaatgtgcattggatgcgccatacgtcaaacgcgcagggtgaggtgatagta
gaaggggactttgacgcctctttagctggcgacgcagagcaactgacaagtagcgaaatt
attgacgtgaaaggtgagttctcggtaggcgacaccattctagtacgtaaagaagacggt
actaaactggtaaaagccaagtcgaattacagtagctgtttattgaatttcattgcgaat
caggaaaacgaagaattcgcccatgagtttgaggaaaagactgggccaattatttctgat
cagcacatagcaaatctggagaaagaatga

DBGET integrated database retrieval system