KEGG   Alteromonas macleodii English Channel 673: AMEC673_09420Help
Entry
AMEC673_09420     CDS       T02254                                 

Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_09420
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMEC673_09420
   00650 Butanoate metabolism
    AMEC673_09420
  Energy metabolism
   00190 Oxidative phosphorylation
    AMEC673_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2201097..2201444
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggttctttattaccacc
gataacctaacgtttatcgaatggcgagggttgttctctggcctggctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcaggactacaatatatcttaaatatcatc
gcgttcggctatgtagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system