KEGG   Alteromonas macleodii English Channel 673: AMEC673_09420Help
Entry
AMEC673_09420     CDS       T02254                                 

Definition
(GenBank) putative succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00020  Citrate cycle (TCA cycle)
amg00190  Oxidative phosphorylation
amg00650  Butanoate metabolism
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01120  Microbial metabolism in diverse environments
amg01130  Biosynthesis of antibiotics
amg01200  Carbon metabolism
Module
amg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMEC673_09420
   00650 Butanoate metabolism
    AMEC673_09420
  Energy metabolism
   00190 Oxidative phosphorylation
    AMEC673_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF2975
Motif
Other DBs
NCBI-ProteinID: AFT74578
UniProt: A0A0E0YE81
Position
2201097..2201444
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggttctttattaccacc
gataacctaacgtttatcgaatggcgagggttgttctctggcctggctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcaggactacaatatatcttaaatatcatc
gcgttcggctatgtagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system