KEGG   Alteromonas macleodii English Channel 673: AMEC673_09440Help
Entry
AMEC673_09440     CDS       T02254                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_09440
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMEC673_09440
  Amino acid metabolism
   00310 Lysine degradation
    AMEC673_09440
Enzymes [BR:amg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMEC673_09440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2206949..2208460
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAPAEAKTESKAKDDSKSDAAPAASGKTSDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEIIAEEGATVTAEEVI
AKFVEGAASGASAPAASSESDDSDESSDALSPSVRRLLAEKGVDAAKVKGTGKNGRITKE
DVEKYLKGGDSSAKAASAASESVSADLPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQDSFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgtaaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaactgttttaggcgagcaagttattgctaaactagaaaagggtggt
gctgctgcaccagctgaagctaaaactgaaagcaaagcgaaagacgattctaaatcagat
gcggctccagcggcttctggaaaaacatctgatgttaaagtaccagtacttcctgaatct
gtagctgacgccacaatcgcaacgtggcacgtagctgtaggtgaagcagtttctcgcgac
caaaatttggttgatatcgaaactgataaagtagtactagaagttgttgctcctgcagac
ggttctcttgctgaaattatcgcagaagagggcgccaccgtaacagctgaagaagtgatt
gctaaatttgtagaaggtgcagcaagcggcgcttctgctccagcagcgtcaagcgaaagc
gatgacagtgacgagagcagcgatgcgcttagtccttctgttcgtcgtttacttgcagaa
aaaggtgttgacgcagctaaagtgaaaggcactggcaaaaatggccgtatcactaaagaa
gacgtagagaaataccttaaaggcggcgacagctcagcgaaggcagcgtctgctgcgtct
gaatctgtttcagctgacttaccaacgggtaatcgtaccgagaagcgtgttcctatgaca
cgtcttcgcaagacaattgctaaccgtcttcttgaagcgaagaactctacagcaatgcta
acaacgtttaacgaagtaaacatgaagccaatcatggatcttcgtaagcagtaccaagac
agcttcgagaagcgtcacggtattcgccttggtttcatgtctttctacgtgaaagcggta
accgaagcccttaagcgtttccctgaagttaacgcgtctatcgacggtgatgacattgtt
tatcacaactacttcgatgtatcgattgctgtttctacaccacgtggccttgtaacacca
gtacttaaagatactgacacactaggcatggcaggtgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcattggctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcactaatgtctacaccaatcattaacccgccacag
agcgctattttgggtatgcataaaatccaagatcgtccaatggctgttaatggcaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcagtaggtttcttggtaaccgttaaagagatgctagaagatccaacacgtctactt
ctagacgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system