KEGG   Alteromonas macleodii English Channel 673: AMEC673_09645Help
Entry
AMEC673_09645     CDS       T02254                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_09645
   01230 Biosynthesis of amino acids
    AMEC673_09645
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMEC673_09645
   00030 Pentose phosphate pathway
    AMEC673_09645
   00051 Fructose and mannose metabolism
    AMEC673_09645
   00052 Galactose metabolism
    AMEC673_09645
  Energy metabolism
   00680 Methane metabolism
    AMEC673_09645
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AMEC673_09645
Protein phosphatases and associated proteins [BR:amg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AMEC673_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266712..2267716)
Genome map
AA seq 334 aa AA seqDB search
MSKRVAILTSGGDAPGMNACIRAAIIACQKANFTLLGYKHGYNGLLQQEFIPLSLDSTHN
LIQQGGTILHSARCKEFKNREGLIKAADNLRQAEIDTLIVIGGDGSFRGAAKLSELWDGQ
ILGIPGTIDNDIAGTDATIGYFTAIDTAMSSIDKVRDTADAFERIFLVEVMGRNAGFLAL
NGALSAAADYVVVPEFFESAETEINKIVNQIKAQRALKGPVSFIVVVAENVWPNGLTGLT
EALQYHNINDVRPVTLGHVQRGGSPVAQDRLLATTLGEFAISLVGSDITNIMVGEVNQRP
ITVPLPKTWEETKPLNQARVDAMRTLMNERYSCD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacgtgtcgcaattttaacctctggtggcgacgccccaggtatgaatgcatgt
atacgtgccgcaattattgcgtgtcagaaagctaattttaccttgcttggctacaagcac
ggctacaatggattactacagcaagagtttattcctctatctcttgattcaacgcacaat
cttatccagcaaggcggcaccatactacacagcgcaagatgtaaagaatttaaaaatcgt
gaagggcttatcaaagcggctgataacttgagacaggccgagatcgacacacttattgta
atcggtggtgacggatcttttcgcggcgcagcaaagttgagcgaactatgggatggccag
attcttggtattccgggaacaattgataacgatatagcgggtactgatgcgactataggc
tactttaccgcaatagataccgccatgagttctatcgataaagttcgtgatacagctgat
gcgttcgaacgtattttccttgtagaagtaatgggtcgcaatgctggctttttagcatta
aatggtgccctttccgcggctgctgactatgtggttgttcctgagttttttgaatccgct
gagactgaaatcaataagatcgtaaaccagataaaagcgcagcgtgctttgaaagggccc
gtcagttttattgttgtagtagctgaaaacgtttggcctaatggcttaacaggattaacc
gaagctttgcagtatcacaatatcaacgacgttaggccagtaaccttgggacatgtccaa
cgtggcggctcgccggtagcacaggaccgactactcgccactactcttggcgaattcgcc
ataagcttagtaggaagcgacatcaccaacataatggttggtgaagttaatcagcgccct
attaccgtacccctacccaaaacttgggaagaaacaaagcccctcaatcaagcccgggtt
gacgctatgcgtaccctaatgaacgaaagatacagctgcgactaa

DBGET integrated database retrieval system