KEGG   Alteromonas macleodii English Channel 673: AMEC673_10620Help
Entry
AMEC673_10620     CDS       T02254                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMEC673_10620
Enzymes [BR:amg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     AMEC673_10620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2496187..2497941
Genome map
AA seq 584 aa AA seqDB search
MAWDHLHDKVKHHLESIYADVSLDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEDD
IIMITYGDSVIDEGERPLVTLNKFLHRYCKNTVNNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEVIAEDYGLMTDLVINHCSARSVWFDNFVKGEGPGSDFFFTADPSDDLSMVT
RPRVSPLLRETETASGTKHVWCTFSHDQVDFDFGNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNCINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVTGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
DEEISELVHTMQHFGGKVSWRASDHGQQKPYEINITLFDALQGTTKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLQLGNQLFGYWRQSLDRKQSIFCISNISDEEQTIL
LSDINLIGTDNWIDLITRDEIALSSGFLQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggaccatctccatgacaaagtaaaacaccatttagaaagcatttatgccgat
gtatcgctggacgtctcgtatgagacgctagcgactgagttaatgaacactataggcatt
cagcagcaaacggatattgcttcacctcagtctcatcacaattattgggatgaagatgac
attatcatgattacctacggtgatagtgtcattgacgaaggggagcgtccgctggttacg
ttaaataagtttttgcaccgctactgcaagaacaccgttaataatgttcacatcctgccc
ttctttccgtacagctcagacgatgggttttcggttatcgactactctacggtgaatgaa
gcactagggtcatgggacgatattgaagtcattgctgaggattatggcttgatgaccgac
ctagttatcaatcactgctctgcaagaagcgtgtggtttgataactttgtgaagggtgaa
ggaccaggatctgactttttcttcacagcagatccatccgatgacctctccatggtaact
cgccctcgtgtgtcgcctttgctgcgagaaacggaaaccgccagcggtacaaagcatgta
tggtgcacatttagtcacgaccaagttgactttgactttggaaaccccaaggtgttgtta
gcgtttatcgatatcatcaagctgtatattgataaaggcgctaaaatctttcgcttagac
gcagtggcatttctttggaaaattgtaggtacaaactgcattaatctattccaaacccac
gaagtcatacgtttgatccgaacgctgattgaacatgtggatccttccatcataatcatt
accgaaaccaatattcccaacagggaaaacctaacgtactttggtaatgctaacgaagcc
catgctatctacaacttttcgcttccgccgttacttgtaaatacattagtaacgggtgat
tgtacgtatttgaaaagctggatgatgagtatgccaccggcgcaaaacggcacagcctac
tttaactttatcgcttcgcacgatggtattggcttgcgtccggcggaaggcctactgtca
gatgaagaaatttcagagcttgtgcatacaatgcagcactttggcggcaaggtgtcgtgg
cgcgcttctgatcacggtcagcaaaagccttacgagataaacatcaccctgttcgacgcg
ctgcaaggaaccaccaagggccctgataagtatcaagtggaccgatttatttgtgctcac
gccataatgttaggtatggaaggtataccaggaatttacattcacagtttacttggcaca
tccaacgattacgaaaaagtcgctaatacaggacaaaatcgttcaatcaacagaaaacgt
tgggactttaatgaattagaggctctgttagactcgcccttttcacagcatcataaagta
ctcactcgaatctcgcagcttatacgtatacgtaaagcgcagcctgcatttcaccccaat
gcaacgcaatttacattgcagcttggtaatcaattatttggctactggcgacaaagtctc
gatagaaagcaaagtattttctgtattagtaatatttcagacgaagaacaaacaattttg
ttgtctgacataaaccttattggcacagataattggattgatctcatcacccgtgacgag
atagccctttctagtggtttcttacaaatgaagccttatcaagtactttggatcagcaac
caagattttgaataa

DBGET integrated database retrieval system