KEGG   Alteromonas macleodii English Channel 673: AMEC673_10800Help
Entry
AMEC673_10800     CDS       T02254                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:amg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:amg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2525422..2525976
Genome map
AA seq 184 aa AA seqDB search
MKAKGFVPALLALSFFTTPSFASECPSVLKFMKRKLNSQETVNLCNEYAGKTLLVVNTAS
YCGYTPQFEGLEALYSDYKDKDFVVLGFPSHDFNQEDNDEGKTAELCELTYGVKFPMFEP
ISVKGEDADPMYRMLKTATGKAPSWNFNKYLIDSSGNQITHYPSSTKPTDPAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaaggttttgtacctgcgttgcttgcgctcagctttttcacgactcctagc
tttgcgagcgagtgccccagcgtactaaagttcatgaagcgtaagctcaactcacaagaa
acggtgaatttgtgtaacgaatatgccggaaagacccttttagtggttaacacagccagc
tattgcggctacacgccacaatttgaaggtttagaagccctttatagtgactacaaagac
aaagattttgtagtacttggcttcccgtcgcacgattttaaccaagaagataatgatgaa
ggcaaaacggcagaactgtgtgaattgacttatggcgtaaagtttccgatgtttgaacca
atatcggtaaaaggtgaagacgccgatcctatgtatagaatgctaaaaaccgccaccggc
aaagcgccatcatggaactttaataagtaccttattgacagctctggtaatcaaataacc
cactaccctagttcaacaaagcccactgatccggcttttatcgctgacatagaggcactc
ctcaaaagcgaataa

DBGET integrated database retrieval system