KEGG   Alteromonas macleodii English Channel 673: AMEC673_11290Help
Entry
AMEC673_11290     CDS       T02254                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2632428..2634635)
Genome map
AA seq 735 aa AA seqDB search
MKSNQHSVPSFFDNLFGIEAIDKFVAKEFGFIDELEQEEQFIWAGILAYLSYMQRNGHSC
IYLKDIAGTTLFKEVVAEQEAVLAAETNVHSNNGAVGASKSPVEQTEQEKAPKAGVDVPQ
LTPLLRIVKSALVNEQVAQLFVYSNGKLYSRRYYEFEQEVARNVVKRAALTPLSDDASEK
VKQLWPAIFPTETTDQQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDTVLNNVPTDAVTLHRLLGLREHGVSTK
FNQHNQLAADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
STEAASFDENANVPNGTNSLNSNDNAFSLDGVPSLMRQHIATLCPHLPLLPVDEQAKSYV
ATLQAPQRFKGQVAKVATAIQRGDASGALAAITDKASDNDETAGLNSNIDSTLVSKTASR
LQSGVHLWPEHQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPVRKGGMGVEG
LNNLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSKGKLYAWFYQD
SQASGQNGSNQKASANAGDSADNTLEQKQALRSISLSRVPQFETVYAMTIHKSQGSEFNH
VVLILPKPDSEKAANLFHRGLVYTGLTRAKDGCLIISDNATFTHMVQRVDKRYSGLSEAI
SLHLESTSNATTEIE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaatcaacactctgtaccgtcattttttgataacttgtttggcatcgaggcg
atcgacaaatttgtcgcaaaagaatttggctttattgatgaactggagcaagaagaacag
tttatttgggctgggatcttagcatacttgtcgtatatgcagcgcaatggccacagctgt
atctatctaaaagacatagcgggtacgacgctttttaaagaggtagtagcagaacaagaa
gcagtcttggcggccgaaacaaatgtgcatagcaataacggagcggttggggcatctaag
tcgccggtagaacaaacagagcaggaaaaagcgcccaaagcaggtgttgacgtgccacaa
ctaacgccgttacttagaattgtaaaaagcgcactggttaacgagcaggtggctcaacta
tttgtctatagcaacggcaagctgtacagccgtcgctactatgagtttgaacaagaagtg
gcgcgcaatgttgtaaaacgagctgcgcttacgccgttaagtgatgacgcaagcgaaaaa
gtaaaacaactttggcccgcaatctttcctaccgaaacaaccgatcagcaagattggcag
caaattgcagtggccaaaagcctaatgcagcgcttttgcgttataaacggtgggccagga
acaggtaagacctatactgtattgcgcttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcagcgcctacaggtaaagcgcaacagcgtatgaccgaatctatc
atgaacagcatagacgggcttcgcggcaagttggacgacacagtgcttaacaacgtgcct
accgatgctgtgacgctacatagattactaggattgcgcgagcacggtgtatcgactaag
ttcaatcagcacaatcaattggcagcagatgtactcattgtcgatgaagcaagtatggtc
gacttagcgctaatgacgcgcatcgtacgagcgttaccagaccatgcgcgactctatttt
atcggtgatgccgatcagcttccagcagttgagcttggcaacgtgttagagcagctagtt
agtaccgaggcagcaagttttgacgaaaatgcgaatgtgccaaatggtacaaatagctta
aacagcaatgacaacgcgttttctttagatggcgtgccatcgttaatgcgtcagcacatc
gctacgctgtgcccgcatttgcctctgttacctgttgatgagcaggcaaaaagctatgta
gcaactctgcaagcaccgcagcgcttcaaagggcaggtggcaaaagttgcaacggccata
cagcgaggtgatgcaagcggtgcacttgccgctattaccgacaaggctagtgacaatgat
gaaactgctggcctcaactcaaatatcgattcaactcttgtttcaaagactgcatcacgc
ctacaatctggcgttcacctatggccagagcaccaggttagcggccgtgatttacaccag
ttggccaaagaaagcttcctgcctatttttgatgctggcagtgccgaagaggcgcttaat
cgtctgaatgtggttaggtggctaaccccggtccgcaagggcggaatgggcgtagaaggc
ctgaataatttggtgttcgatgctatcaagcacaaaatcagaaagcgggaaggccatttc
tatcaaggtcagcccattatgattgtaaagaatcatcatcctcaacgactatcaaacggt
gaggttggtgtaatctggcctgacagcaaaggaaagctatatgcgtggttttaccaggat
agccaagcttcgggtcaaaacggttcaaatcagaaagcttcggcaaatgcgggagacagt
gctgacaatacgctagagcaaaagcaagcgttgcgcagcatatcgctatcaagagtaccg
cagtttgaaactgtgtacgccatgaccatacataaatctcagggctctgagtttaatcat
gttgtgcttattttacctaagcctgatagcgaaaaagccgccaacttatttcatcgaggc
ctagtgtacacagggttaacccgtgccaaagacggctgcttaatcatttctgacaacgca
acatttacccacatggttcaacgggtagataagcgttattccgggctgtctgaagcgatt
agcctgcacctagagagcacatcaaacgccaccacagaaattgaataa

DBGET integrated database retrieval system