KEGG   Alteromonas macleodii English Channel 673: AMEC673_11505Help
Entry
AMEC673_11505     CDS       T02254                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2682948..2685131)
Genome map
AA seq 727 aa AA seqDB search
MQLAQQFEQVLCSQPFSHLGVVKNQQKSVLRVWRPNVSKITIKWENAALANVTVTSKNGL
FETPLPKEYQGEVYRVIAEGLNDDKGYIDPYQFSEQAYHAVHYIDSKPSNLYEQAGAQLL
TLTSSKGDAIKGVRFCVLAPNASTVSLIGDFNQWDGRTYPMEKTSMGYWVLFVPELAEGE
RYKYHIKDSHGHDLPHKADPLGFSAEQYPSHASKIYNHNNYEWNDSAWMEKRKGNKYNSP
MSIYEVHLGSWKRPGIETDARYLTYKALADDLISYVSDMGYTHVELLPISEFPFDGSWGY
QPVGMFAPTSRFGNPDEFKYFVDKAHQAGIGVIIDWVPAHFPEDGHGLARFDGSCVYEYE
DPRKGWHPDWNSCIYDFGKDTVRQFLVANALFWLDKFHVDGLRVDAVASMLYLDYSRNDG
EWIPNVDGGNENYEAISLLKWMNEEVYKHFPDAMTIAEESTSFPKVSRPVFDGGLGFGFK
WNMGWMHDSLHYIAKDPAYRNYHHGDITFSMVYAFDENFVLPISHDEVVHGKGSMLHKMP
GDEWQQAANLRCYAGFMYGHPGKKLNFMGNELAQAREWNHDSSLDWHLLDYEKHKGIQAL
YKALNHLYTSTPALYEQDHEPGGFAWLDHNNADQSVVSFVRMSKDAKQKVYVVSNFTPVP
RQNFRIGVDDACTLTLALNTDDGAYWGSGYDVASTVNTQTIPWNERTHSAEITLPPLATV
FYVANVD
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagcgcagcagtttgaacaggtattatgttctcagccgttttcccatttaggt
gtagttaaaaatcagcagaagtcggtacttcgcgtttggcgtcctaatgtcagcaagata
acgattaaatgggagaatgcagcgctagcaaatgtaaccgttacctccaaaaatggtctt
tttgaaacaccactgcctaaagaatatcagggtgaggtttatcgcgttatcgccgaaggt
ttgaatgacgacaagggctatatcgatccttatcaattctccgagcaggcgtatcatgcg
gtacattacatcgatagcaagccttcaaacttgtacgagcaagcgggcgcgcaactttta
acactcacttcttcaaaaggcgatgcgataaaaggtgtcaggttctgcgttttagcgccc
aatgcgagtacggtgtcgctcattggcgatttcaatcagtgggatggccgcacgtatcct
atggaaaagacctctatgggatactgggtactgtttgtgccagaactcgcagagggagag
cgctacaagtatcacattaaagattcacacggccacgacctaccgcacaaggctgaccca
cttggcttcagtgcagagcagtatccttctcatgcttcgaaaatttacaaccacaataac
tatgagtggaatgatagtgcatggatggaaaagcgaaagggaaataaatacaacagccca
atgagcatttatgaggtgcaccttggctcttggaagcgcccgggtattgaaactgatgcg
cgctatcttacttataaagcgctggccgatgacttaataagctacgtcagcgatatgggt
tacactcacgttgaattgctgcctatttccgagtttcctttcgacggttcgtggggctat
cagcccgtgggaatgttcgcaccaacgagtagatttggaaacccagatgaatttaaatac
tttgttgataaggctcaccaagcaggtataggcgtaattatcgactgggtacctgcacat
ttcccggaagacggccatggcttggcgcgatttgatggttcttgtgtttatgaatatgaa
gatccgaggaaaggttggcatccggattggaattcttgcatttacgatttcggcaaagac
acagttcgtcaatttttagttgcaaacgcactgttttggctagacaaatttcacgttgat
ggactcagggttgatgcagtggcatccatgctttatctcgactattcacgcaatgacgga
gagtggatcccgaatgtggatggtggcaacgaaaactacgaagccatcagcttactgaaa
tggatgaatgaagaagtgtacaagcacttcccagacgccatgacaattgccgaagaatca
acgtcgtttcccaaggtttctcgcccagtatttgatggtggtttgggctttggctttaag
tggaacatggggtggatgcacgactcattacactacatcgctaaagaccccgcctatcgc
aactatcaccatggcgatattaccttcagcatggtttacgcgtttgacgaaaactttgtg
ctgcctatctcgcacgatgaagtggtacacggcaaaggcagtatgctgcataaaatgcct
ggcgatgaatggcagcaagctgctaacctgcgttgttacgcgggctttatgtacggtcac
cccggcaagaagcttaactttatggggaacgagcttgcgcaggcacgagaatggaaccat
gacagtagtctagactggcacttgctcgattacgaaaaacacaaaggcattcaagcgctt
tataaggcgctcaaccacctctatacgtctacgccagcgctttacgagcaagaccacgaa
ccagggggctttgcttggctggaccacaataatgcagaccaaagcgtggtttcatttgtt
cgcatgtcaaaagatgcgaagcaaaaagtatatgtggtatctaattttacgcctgtgcca
cgtcagaacttcagaataggcgtagatgatgcatgcacgctaacgctagcactaaacact
gatgatggtgcatattggggtagtggctacgacgttgcttctactgttaatacgcaaacc
ataccttggaatgagcgtactcactctgcagaaatcacgttaccgccgctagccacggta
ttttatgttgccaatgtggattaa

DBGET integrated database retrieval system