KEGG   Alteromonas macleodii English Channel 673: AMEC673_11520Help
Entry
AMEC673_11520     CDS       T02254                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00010  Glycolysis / Gluconeogenesis
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
amg01120  Microbial metabolism in diverse environments
amg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMEC673_11520
Enzymes [BR:amg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AMEC673_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFT74994
UniProt: A0A0E0YCQ5
Position
2688908..2689759
Genome map
AA seq 283 aa AA seqDB search
MPPVSSVTVSESNGLTFLDVDNAFASARISLFGGHILSYVPKSDGRERLWVSPHAYLNGE
RPIRGGIPVCWPWFSDDHGREKGALPAHGFLRTQVWKLIHSEDTESGTTITLSPSFTRAE
GFENDCNVTMVITVGETMDVALTTENTGVVPFEFNCALHTYFHVDHIQHTQITGIEGQYK
DKLDDWGLKTTPSPYTITGETDRIHVAPIKTAEIEVEGNAFTEVVSDGNDSLVVWNPWLG
AASISDMDPFGYKHMLCVETSLTQGKTLSPGASHTLKQTIVPK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgtgagttcagttaccgttagtgagtctaatggacttacctttttagacgta
gataatgcgtttgcctctgcgcgtattagcctatttggcggtcatatcttgtcatatgtg
cctaaaagcgatggcagagagcgtctttgggtaagcccccatgcttacttgaacggagag
cgacctattcgcggtggtattccggtgtgctggccttggtttagcgatgatcacggtcga
gaaaaaggtgccctccccgctcacggctttttgagaacacaagtgtggaagctgattcat
tcagaagatacagaaagcggaacaacgattacgctttcgccaagttttacccgagcagaa
gggtttgagaacgattgtaacgtgaccatggtaattaccgttggtgagacgatggacgtc
gcgctaactacagaaaatacgggtgttgtaccattcgaatttaactgtgcgctacataca
tatttccacgttgaccacattcaacatacccaaataactggaattgaaggtcaatataaa
gacaaacttgacgactggggacttaagacgacaccgagtccttacaccatcacaggcgaa
acggatcgcattcatgttgcgccgattaaaacggcagaaattgaagtcgaaggcaacgcg
ttcacggaagtggtatccgacggcaatgactctttggtagtgtggaacccgtggttaggc
gcagcgtctatttcagacatggacccctttggctataagcatatgttgtgcgtagaaaca
tcgctaactcagggaaagacactgtcccctggtgctagccacacactgaaacaaactatt
gttccgaagtaa

DBGET integrated database retrieval system