KEGG   Alteromonas macleodii English Channel 673: AMEC673_11700Help
Entry
AMEC673_11700     CDS       T02254                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMEC673_11700
   00500 Starch and sucrose metabolism
    AMEC673_11700
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AMEC673_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2733027..2734217
Genome map
AA seq 396 aa AA seqDB search
MEFNKARVSLSLAFVLLAGILFSGLSAAMPASTDVVVAKSHDSDVSKDALPHFNSVSQAV
TYIASHKPQKDKVWTVFINEGIYRERVVINVDNVHFVGQSQETTTIVFNRYAGQQVAENA
QEKWGTRRTATVEILGDNITLENITITNDFDYPGNEVKAKDDPTRLSGTQAVALKTDVNS
DRTYLKNVALWGYQDTLYLKGDRALIEGGTIAGHIDFIFGEGTAFFESVSIVSRTRYSGG
DSEGLTGYITAPSTHLQRPYGLTFNNCRLEREQGVPDESVALGRPWHPTTTFSDGRYANP
YAVGKTTFINTYMAGHIIQKRWTTMGGTTPSGTKRPFNPHTEARFSEYQSHGEGAPKAVS
SPAINSHFLNDKNAAFYTKEAVLRGWVPNNIPNDIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaataaagcacgtgtcagtcttagtttagcctttgtgttgctggcaggtata
cttttcagtggattaagcgcggcaatgccagcatcgacggatgtagtggtagctaaatca
catgacagtgacgtaagtaaggacgctttacctcattttaactctgtgtcccaagctgtt
acttatatcgcgtctcacaagccacaaaaagataaagtatggaccgtctttattaacgaa
ggcatttatcgagagcgtgtcgtcataaacgttgataatgttcactttgtgggccagtcg
caagaaacaacgactatcgttttcaatcggtatgcaggtcaacaagtcgcagaaaatgct
caagaaaaatggggaactcgtcgcactgccactgtggagattttaggtgataatatcact
ctggaaaatatcactatcaccaatgattttgattatcccggtaacgaggtcaaagcaaaa
gacgaccctactcgattatcaggtacgcaggcagtagcgcttaaaaccgatgtgaactca
gatcgcacttaccttaaaaatgtcgcactctggggttaccaagataccctctatttaaaa
ggtgaccgcgctctgattgaaggcggaacaatagcaggacatattgactttatttttggt
gagggcaccgcgttttttgaaagcgtttctattgtttcccgtacacgttattctggcggt
gatagcgaaggactaacaggctacattaccgccccaagcactcatttacagcgtccttat
gggttaacgttcaataactgtaggcttgaaagagaacaaggcgttccagatgaaagcgtg
gcactgggaaggccttggcatcctacaaccaccttttcagatggccgatatgcaaaccct
tacgctgtaggtaaaaccacgtttatcaacacctatatggcaggtcatatcatccaaaag
cgctggactactatgggtggaactacgccatcaggtacaaagagaccatttaatccccac
acagaagcaagattttccgagtaccaatctcatggagaaggtgcacctaaagcagtctcc
tcaccagcaataaactctcattttctgaatgataaaaacgcggctttttacactaaagag
gcggtattgcgaggctgggtgcctaataacatcccgaacgatattaaatag

DBGET integrated database retrieval system