KEGG   Alteromonas macleodii English Channel 673: AMEC673_11905Help
Entry
AMEC673_11905     CDS       T02254                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2784442..2785938
Genome map
AA seq 498 aa AA seqDB search
MSIRNGVQLITYADRLGDGNIESLTSILQGPLGGLFTGVHILPFYYPYDGEDAGFDPIDH
TLVDERLGDWDNVKKLGESVDIMADLIVNHMSGQSEAFKDVLKNGRESSYWPLFLTKEDI
FKGNDQTQIDEQIAQVFRPRPTPFFSDYEVGTETGNPETVPFWTTFTSNQIDIDVESQLG
KDYLSSILQSFTESNVDLIRLDAAGYAIKRAGSNCFMLEETFEFIEELSNRARGMGMQCL
VEIHSHYQTQIDIAARCDSVYDFALPPLVLHTLFSKNAEALAYWLSISPRNCFTVLDTHD
GIGIVDVGANGDKPGLLTADAINSLVDQIHENSNGESKKATGAAANNVDLYQVNCTYYDA
LGKDDFAYLVARAIQFFSPGIPQVYYGGLLAVENDMALLAKTNVGRDINRPYLSTAMVKE
AVEKPVVKGLMQLIRLRNESDAFNGVFDVSYINNVFVLSWKNGNHAASLNVNFSTMDATI
HTVDNGEESVLSINTLLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctatacgcaatggcgttcaactaatcacctatgcagaccgactaggcgatggcaac
atcgagagtctaacaagcatacttcagggcccgttaggtggcctgtttacgggtgttcac
atccttcctttttactacccttacgatggtgaagacgcgggtttcgatcctatcgatcat
accttggtcgatgagcgcttgggcgattgggacaacgttaaaaagcttggcgaatcggta
gatatcatggccgacctcattgttaaccatatgtcggggcaaagtgaagcgttcaaagac
gtgctgaaaaacgggcgcgaatcgagttattggccgctgttcttaaccaaggaagatatt
tttaagggcaacgatcaaacgcaaattgacgaacaaatagcacaagtgttccgccctcga
cccacaccgtttttcagcgattacgaggtgggcacagagactggtaaccctgaaaccgtg
ccgttctggacaacttttacctctaatcaaattgatattgatgtggagtcacagttaggc
aaagactacctatcttctattcttcagtcgtttactgaaagtaatgttgatcttattcgc
ttagatgcggcgggctatgcaattaaacgcgcgggttcgaactgctttatgcttgaagaa
accttcgaatttatcgaagaattatcaaaccgcgcacgtggtatgggcatgcagtgtttg
gtcgaaatacacagtcactatcaaactcaaattgatattgctgcgcgttgcgacagtgtt
tacgacttcgctttacctccgcttgtactacacaccttgttctctaaaaatgcagaggca
ttggcatactggctttcaatttcgccacgtaactgctttaccgtgctagatactcacgat
ggcatcggcattgttgacgtgggcgcgaatggtgacaaaccaggcctgcttaccgcagat
gcgattaattcgctcgttgaccaaatacatgaaaattccaatggcgagtctaaaaaagcc
accggtgccgctgcaaataatgtagacctttaccaggtaaactgcacatattacgatgcg
ttaggtaaagatgacttcgcttatttggttgcacgcgccattcaattttttagcccgggt
atccctcaagtttattacggtggcttgcttgctgttgaaaacgacatggctttacttgct
aaaaccaatgttggccgcgacatcaaccgcccatacttgtctactgccatggtaaaagaa
gccgttgaaaagccagtggttaaaggcctgatgcagcttattaggctaagaaacgaaagc
gatgcttttaacggtgtatttgacgtgagttacatcaacaacgtattcgtgctttcgtgg
aaaaacggcaaccatgcggcgtcactaaacgtgaacttcagcacaatggatgcaactatt
catacggtggataatggtgaagaaagcgtgttgtcaatcaacacgctacttgcttaa

DBGET integrated database retrieval system